Gene Information

Name : arsCb (HEAR1960)
Accession : YP_001100233.1
Strain : Herminiimonas arsenicoxydans
Genome accession: NC_009138
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : 1.20.4.1
Position : 1978736 - 1979158 bp
Length : 423 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 7721697, 3021763, 1703401; Product type e : enzyme

DNA sequence :
ATGAGCCACATCACGATCTACCACAATCCCGATTGCGGCACGTCACGCAACGTCCTCAGCCTGATTCGCAACAGCGGCGA
GGAACCGGCTGTCATCGAATATCTGAAGACACCGCCCGACCGCGACATGCTGAAGGCGCTGATCGCCGCGATGGGCATCC
CGGTACGCGCGGTGCTGCGCGAGAAAGGCACGCCGTATGCGGAACTCGGCCTGGGAGATCAGAAGTGGAGCGACGAGCAA
TTGATCGACTTCATGCTCCAACATCCGATCCTCATCAACCGACCTATCGTGGTCACGCCGCTGGGCACGCGCCTGTGCCG
CCCGTCGGAAACAGTGCTCGACATCCTGCCGCAACCGCAGCGCGGCGCGTTCAACAAGGAAGACGGCGAGCCGGTAGTGG
ATGTGGAGGGCCGTCGTGTCTGA

Protein sequence :
MSHITIYHNPDCGTSRNVLSLIRNSGEEPAVIEYLKTPPDRDMLKALIAAMGIPVRAVLREKGTPYAELGLGDQKWSDEQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSETVLDILPQPQRGAFNKEDGEPVVDVEGRRV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 5e-47 72
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 1e-42 59
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 9e-43 59
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 1e-42 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsCb YP_001100233.1 arsenate reductase BAC0584 Protein 8e-50 73
arsCb YP_001100233.1 arsenate reductase BAC0583 Protein 1e-48 73
arsCb YP_001100233.1 arsenate reductase BAC0585 Protein 2e-47 72
arsCb YP_001100233.1 arsenate reductase BAC0582 Protein 1e-48 71