Gene Information

Name : HEAR0604 (HEAR0604)
Accession : YP_001098931.1
Strain : Herminiimonas arsenicoxydans
Genome accession: NC_009138
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 604875 - 605570 bp
Length : 696 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11004187, 11399769, 11283292, 8449873, 8078459; Product type r : regulator

DNA sequence :
ATGCGCATCCTAGTCATTGAAGACGAACCCAAGATAGGTGACTATCTGGTACGCGGCCTGGCCGAGTCGGGCTTCACGGT
TTGCCTTGCTCGCAATGGCCGTGATGGCCTGTTTATGGCGACACACGAAGCCGTCGATCTGATTGTGCTTGATATGATGC
TGCCGCTACTGAGCGGCTGGGAATTGTTGACGGCTTTGCGCAGCCAGGCAGACAAGCAGCACATCCCTGTTATTTGTCTT
ACCGCACGTGGTGAAGTGGAAGACCGGGTAAAGGGGCTTGAACTCGGCGCCGACGATTATCTGATTAAACCCTTTGCCTT
TGTCGAACTCCTGGCACGTATTCGTACCCTCCTGAGACGCAGTCCGGTACGTGACGAAGACTTCATTCGTATCGGCGATA
TGGAAATCGACGTGATGAAGCGCAAGGTGATGCGTAACGGCAAGCGCATCACTCTCACTGCCAAGGAATTCGGGTTGCTG
CATTTGCTGGCACGTCGTCAGAGTGAAGTGTTGTCGCGTTCAGTGATTGCCTCCCAAGTCTGGGATATCAACTTTGAAAG
CGACACCAATGTGATTGATGCGGCAGTGCGGCGACTGCGCTCCAAAATCGATGACCCATTCGAGACTAAACTGATTCATA
CCCAGCGTGGGATGGGCTATGTCTGCGAAGTCCGGGATCCCGAGCCGCAGGTATGA

Protein sequence :
MRILVIEDEPKIGDYLVRGLAESGFTVCLARNGRDGLFMATHEAVDLIVLDMMLPLLSGWELLTALRSQADKQHIPVICL
TARGEVEDRVKGLELGADDYLIKPFAFVELLARIRTLLRRSPVRDEDFIRIGDMEIDVMKRKVMRNGKRITLTAKEFGLL
HLLARRQSEVLSRSVIASQVWDINFESDTNVIDAAVRRLRSKIDDPFETKLIHTQRGMGYVCEVRDPEPQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-56 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-55 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HEAR0604 YP_001098931.1 two-component system response regulator BAC0083 Protein 2e-61 61
HEAR0604 YP_001098931.1 two-component system response regulator BAC0638 Protein 4e-58 61
HEAR0604 YP_001098931.1 two-component system response regulator BAC0125 Protein 9e-64 60
HEAR0604 YP_001098931.1 two-component system response regulator BAC0197 Protein 1e-63 59
HEAR0604 YP_001098931.1 two-component system response regulator BAC0308 Protein 7e-62 59
HEAR0604 YP_001098931.1 two-component system response regulator BAC0111 Protein 5e-61 57
HEAR0604 YP_001098931.1 two-component system response regulator BAC0347 Protein 1e-53 53
HEAR0604 YP_001098931.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-35 43
HEAR0604 YP_001098931.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-30 42
HEAR0604 YP_001098931.1 two-component system response regulator HE999704.1.gene1528. Protein 5e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HEAR0604 YP_001098931.1 two-component system response regulator VFG0596 Protein 7e-57 56
HEAR0604 YP_001098931.1 two-component system response regulator VFG1389 Protein 5e-36 44
HEAR0604 YP_001098931.1 two-component system response regulator VFG1390 Protein 2e-39 43