Gene Information

Name : SACE_0266 (SACE_0266)
Accession : YP_001102542.1
Strain : Saccharopolyspora erythraea NRRL 2338
Genome accession: NC_009142
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 302031 - 302699 bp
Length : 669 bp
Strand : -
Note : -

DNA sequence :
GTGGAGGACGACAACGCGCTGGCCGAGGCCCTGGCACTGGCGCTGGGCGGCCTCGGCCACGACGTGCGGGTCGCGGCGTC
CGGCGAGCAGGCGCTGGGGCTGATGTCCGACGACGCGGCGACCGACGTGGTGCTGCTCGACGTCATGCTGCCCGGCATCG
ACGGTTTCGAGGTCTGCCGCCGCATCCGCGCGGCGAGCACGGTGCCGCTGATCCTGCTTACCGCCCGCGGCGACCCGGTC
GACGTGGTCGTCGGCCTGGAGCACGGCGCCGACGACTACGTGGTCAAGCCCACCGAACCGCGCGTGCTCGACGCCAGGAT
GAAAGCCGTGCTGCGCCGGTCGGCGCCCTCCCCGGCCGGTTCCCGGCCCGGCATGCGCTTCGGCTCGCTGGAGATCGACC
CGCTGGCGATGACCGTCACCCGCAACGGCGAGGAGCTCCAGCTCACCGCCACCGAACTGCGCCTGCTGCTGGAGTTCGCC
GACCACCCCGGGCAGGTGCTCAGCAGGCAGGTGCTGCTCAAACAGGTCTGGGACTACGGCTACGTCGGTGACTCCCGCAT
GGTCGACGCCGCGGTGGCCAGGCTCCGCGCGAAGATCGAGGAGGACCCCGCGCACCCCGTCCTGCTGCGCACCGTGCGAG
GTCTCGGCTACCGGTGGGAGCGGCCGTGA

Protein sequence :
MEDDNALAEALALALGGLGHDVRVAASGEQALGLMSDDAATDVVLLDVMLPGIDGFEVCRRIRAASTVPLILLTARGDPV
DVVVGLEHGADDYVVKPTEPRVLDARMKAVLRRSAPSPAGSRPGMRFGSLEIDPLAMTVTRNGEELQLTATELRLLLEFA
DHPGQVLSRQVLLKQVWDYGYVGDSRMVDAAVARLRAKIEEDPAHPVLLRTVRGLGYRWERP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 5e-19 42
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 9e-21 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 9e-21 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 9e-21 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 9e-21 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-22 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-21 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_0266 YP_001102542.1 two-component system response regulator AE000516.2.gene3505. Protein 6e-29 52
SACE_0266 YP_001102542.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-30 50
SACE_0266 YP_001102542.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_007622.3794472.p0 Protein 9e-30 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_003923.1003749.p0 Protein 9e-30 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-29 45
SACE_0266 YP_001102542.1 two-component system response regulator BAC0197 Protein 7e-22 45
SACE_0266 YP_001102542.1 two-component system response regulator BAC0111 Protein 1e-21 43
SACE_0266 YP_001102542.1 two-component system response regulator BAC0083 Protein 2e-22 43
SACE_0266 YP_001102542.1 two-component system response regulator CP000034.1.gene3671. Protein 4e-25 43
SACE_0266 YP_001102542.1 two-component system response regulator BAC0638 Protein 3e-21 42
SACE_0266 YP_001102542.1 two-component system response regulator NC_012469.1.7686381. Protein 1e-27 42
SACE_0266 YP_001102542.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-27 42
SACE_0266 YP_001102542.1 two-component system response regulator BAC0125 Protein 5e-20 42
SACE_0266 YP_001102542.1 two-component system response regulator BAC0039 Protein 6e-22 41
SACE_0266 YP_001102542.1 two-component system response regulator BAC0596 Protein 2e-21 41
SACE_0266 YP_001102542.1 two-component system response regulator CP000034.1.gene2186. Protein 6e-22 41
SACE_0266 YP_001102542.1 two-component system response regulator NC_002695.1.916589.p Protein 6e-22 41
SACE_0266 YP_001102542.1 two-component system response regulator CP001138.1.gene2239. Protein 2e-21 41
SACE_0266 YP_001102542.1 two-component system response regulator CP000647.1.gene2531. Protein 1e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_0266 YP_001102542.1 two-component system response regulator VFG1563 Protein 2e-22 42
SACE_0266 YP_001102542.1 two-component system response regulator VFG1702 Protein 8e-22 42
SACE_0266 YP_001102542.1 two-component system response regulator VFG1389 Protein 2e-19 42
SACE_0266 YP_001102542.1 two-component system response regulator VFG0596 Protein 4e-19 41
SACE_0266 YP_001102542.1 two-component system response regulator VFG1390 Protein 8e-25 41