Gene Information

Name : SACE_5286 (SACE_5286)
Accession : YP_001107450.1
Strain : Saccharopolyspora erythraea NRRL 2338
Genome accession: NC_009142
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5910167 - 5910841 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
GTGCGGGTGCTGGTGGTCGAGGACGAGCCGGGCGTGCGCGACGCCGTGGTCCGCGGGCTGGAGAGCGAGGGCTACGAGGT
CCGGGCGGCCGGGGACGGCGCGAGGGCGCTGACCGAGATCACCGCGTGGCGGCCCGGGGCGATCGTGCTCGACCTGCTGA
TGCCGTTCATGGACGGGCTGACGATGTGCCGTCGGCTGCGCGCCGACGGCGACCGCACGCCGATCCTGGTGCTCACCGCG
CGCGACGCGGTCGCCGACCGGATCGACGGGCTCGACGCCGGCGCCGATGACTACCTGGTCAAGCCCTTCGACCTGGACGA
GCTGCTCGCGCGGGTGCGGGCGCTGCTGCGGCGCAGCTACCCCGGTGACGACACCGTGCTGCGCTGCGCGGACCTGGCGG
TGGACACCGGGGCGCACCGGGTCCGTCGCGGGCACCGGACGGTGGAGCTCAGCCGGACCGAGTACGCGCTGCTGGAGGTG
CTGCTGCGCAACGCCGGTCAGGCGATGCCGCGCGGGCTGCTCGTCGAGCGGGTGTGGGGCCAGGACTTCGGGCCGTCGTC
GAACTCGCTGGAGGTCTACGTCCGCTACCTGCGGCGCAAGCTCGAGGCCGGCGGCGAACCGAGGCTGGTGCACACCGTGC
GCGGCGTCGGGTACCGGCTCGACGAGTCGCCCTGA

Protein sequence :
MRVLVVEDEPGVRDAVVRGLESEGYEVRAAGDGARALTEITAWRPGAIVLDLLMPFMDGLTMCRRLRADGDRTPILVLTA
RDAVADRIDGLDAGADDYLVKPFDLDELLARVRALLRRSYPGDDTVLRCADLAVDTGAHRVRRGHRTVELSRTEYALLEV
LLRNAGQAMPRGLLVERVWGQDFGPSSNSLEVYVRYLRRKLEAGGEPRLVHTVRGVGYRLDESP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_5286 YP_001107450.1 two-component system response regulator BAC0125 Protein 4e-35 44
SACE_5286 YP_001107450.1 two-component system response regulator BAC0083 Protein 1e-34 44
SACE_5286 YP_001107450.1 two-component system response regulator BAC0638 Protein 5e-27 44
SACE_5286 YP_001107450.1 two-component system response regulator BAC0308 Protein 4e-35 43
SACE_5286 YP_001107450.1 two-component system response regulator BAC0197 Protein 5e-32 43
SACE_5286 YP_001107450.1 two-component system response regulator AE000516.2.gene3505. Protein 3e-33 42
SACE_5286 YP_001107450.1 two-component system response regulator Y16952.3.orf35.gene. Protein 2e-25 41
SACE_5286 YP_001107450.1 two-component system response regulator NC_002516.2.879194.p Protein 5e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_5286 YP_001107450.1 two-component system response regulator VFG1390 Protein 2e-52 57
SACE_5286 YP_001107450.1 two-component system response regulator VFG1389 Protein 3e-38 49
SACE_5286 YP_001107450.1 two-component system response regulator VFG1386 Protein 1e-37 46
SACE_5286 YP_001107450.1 two-component system response regulator VFG0596 Protein 4e-29 41