Gene Information

Name : SACE_0761 (SACE_0761)
Accession : YP_001103028.1
Strain : Saccharopolyspora erythraea NRRL 2338
Genome accession: NC_009142
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 852079 - 852774 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATCCTCGTCGTCGACGACGACCGCGCCGTGCGCGAGTCTCTCAGGCGGTCGTTGCAGTTCAACGGTTACCAGGT
CGAGCTCGCCGCGGACGGTCAGCAGGCACTCGACTGGCTCGCGGCCCAGCGGCCCGACGCCATGGTTCTCGACGTCATGA
TGCCCAGGGTGGACGGGCTGGAGGTCGCGCGCCGGCTCCGCAGCACCGGCGACGACCTGCCGATACTCGTGCTCACCGCC
CGCGACGCGGTGTCCGACCGGGTCGCCGGGCTCGATGCCGGTGCCGACGACTACCTGCCCAAGCCGTTCGCCCTGGAGGA
ACTCCTCGCCCGCCTGCGCGCGCTCCTGCGCCGCGCGGCGCCGTCGGACGTCGACCGCGAGGACCGGCCGGAGCCGTTGC
GGTTCTCCGACCTGGAGCTGGACCCTGGCACCAGGGAGGTCCGCCGCGGCGAGCGCCCGATCAGCCTCACCCGGACCGAG
TTCGCACTGCTGGAACTGCTGATGGCGCACCCCAAGCAGGTGCTGACCCGCAGCAGGCTCCTGGAGGACGTCTGGGGCTA
CGACTTCCCGACCTCCGGCAACGCCCTGGAGGTCTACATCGGTTACCTGCGGCGCAAGACCGAGGCGGAGGGCGAGCCGC
GGCTGATCCACACCGTGCGCGGTGTCGGCTACGTCCTGCGGGAGACGCCGCCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLQFNGYQVELAADGQQALDWLAAQRPDAMVLDVMMPRVDGLEVARRLRSTGDDLPILVLTA
RDAVSDRVAGLDAGADDYLPKPFALEELLARLRALLRRAAPSDVDREDRPEPLRFSDLELDPGTREVRRGERPISLTRTE
FALLELLMAHPKQVLTRSRLLEDVWGYDFPTSGNALEVYIGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_0761 YP_001103028.1 two-component system response regulator BAC0083 Protein 2e-33 46
SACE_0761 YP_001103028.1 two-component system response regulator BAC0125 Protein 3e-33 44
SACE_0761 YP_001103028.1 two-component system response regulator HE999704.1.gene1528. Protein 8e-38 44
SACE_0761 YP_001103028.1 two-component system response regulator CP004022.1.gene3215. Protein 2e-27 43
SACE_0761 YP_001103028.1 two-component system response regulator BAC0197 Protein 7e-29 43
SACE_0761 YP_001103028.1 two-component system response regulator BAC0638 Protein 2e-25 43
SACE_0761 YP_001103028.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-35 42
SACE_0761 YP_001103028.1 two-component system response regulator BAC0308 Protein 3e-30 42
SACE_0761 YP_001103028.1 two-component system response regulator BAC0111 Protein 4e-33 42
SACE_0761 YP_001103028.1 two-component system response regulator CP000034.1.gene3834. Protein 3e-22 42
SACE_0761 YP_001103028.1 two-component system response regulator CP000647.1.gene4257. Protein 9e-22 42
SACE_0761 YP_001103028.1 two-component system response regulator NC_002695.1.915041.p Protein 3e-22 42
SACE_0761 YP_001103028.1 two-component system response regulator BAC0533 Protein 9e-22 42
SACE_0761 YP_001103028.1 two-component system response regulator AE000516.2.gene3505. Protein 4e-32 42
SACE_0761 YP_001103028.1 two-component system response regulator BAC0347 Protein 5e-28 41
SACE_0761 YP_001103028.1 two-component system response regulator CP001918.1.gene5135. Protein 4e-18 41
SACE_0761 YP_001103028.1 two-component system response regulator CP001138.1.gene4273. Protein 5e-22 41
SACE_0761 YP_001103028.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-31 41
SACE_0761 YP_001103028.1 two-component system response regulator CP000034.1.gene3671. Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_0761 YP_001103028.1 two-component system response regulator VFG1390 Protein 7e-77 81
SACE_0761 YP_001103028.1 two-component system response regulator VFG1389 Protein 6e-44 51
SACE_0761 YP_001103028.1 two-component system response regulator VFG1386 Protein 2e-47 48
SACE_0761 YP_001103028.1 two-component system response regulator VFG0473 Protein 7e-23 42
SACE_0761 YP_001103028.1 two-component system response regulator VFG0596 Protein 1e-31 41
SACE_0761 YP_001103028.1 two-component system response regulator VFG1702 Protein 5e-29 41