Gene Information

Name : Bcep1808_6406 (Bcep1808_6406)
Accession : YP_001115558.1
Strain :
Genome accession: NC_009254
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 991468 - 992145 bp
Length : 678 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bch:Bcen2424_6324 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGCATCCTGATAGTCGAAGACGAACCGAAGACGGGCGCGTACCTGAAGAAGGGTCTGGAGGAGTCCGGATTCAGCGT
CGATCTCGCCAAAGACGGCGGTGAAGGGCTGATGCTCGCGCAGGAAGAGCGCTACGACGTGATCGTGCTCGACGTGATGC
TGCCCGTGCTCGACGGCTGGGGCGTGCTCAAGCGGCTGCGCGACACGCACACCACGCCCGTGCTGTTCCTGACCGCGCGC
GACGACGTGCAGGACCGCGTGCATGGGCTCGAACTCGGCGCCGACGACTACCTCGTGAAGCCGTTCGCCTTCGTCGAGCT
GCTGGCGCGCATCCGCACGCTCGCGCGTCGCGGCCCGCCGCGCGAAACCGAGCATCTGGCGGTCGGCGATCTGGAGATCG
ACGTGGTGCGCCGCCGCGTGAAGCGCGGCGCCGTGCGGATCGACCTGACGCCGCGCGAATTCTCGCTGCTGCAACTGCTC
GCGCGCCGGCAGGGCGAGGTGCTGAGCCGCACGCAGATCGCGTCCTACGTCTGGGACATGAATTTCGACAGCGACACCAA
CGTCGTCGAAGTCGCGATCCGGCGGCTGCGCGCGAAGATCGACGATGCCTTCCCGGTGAAGCTGATCCATACGGTGCGCG
GCGTCGGCTACGTGCTCGAACCGAAGGACGACGCGTGA

Protein sequence :
MRILIVEDEPKTGAYLKKGLEESGFSVDLAKDGGEGLMLAQEERYDVIVLDVMLPVLDGWGVLKRLRDTHTTPVLFLTAR
DDVQDRVHGLELGADDYLVKPFAFVELLARIRTLARRGPPRETEHLAVGDLEIDVVRRRVKRGAVRIDLTPREFSLLQLL
ARRQGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIHTVRGVGYVLEPKDDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-55 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-54 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator BAC0125 Protein 5e-68 68
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-67 66
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator BAC0083 Protein 5e-64 63
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-55 62
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-58 59
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator BAC0308 Protein 8e-61 59
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-53 56
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-37 44
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 5e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 3e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 4e-33 43
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-31 42
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 3e-28 42
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 7e-33 42
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 6e-27 42
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator VFG0596 Protein 3e-55 56
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-38 50
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-38 48
Bcep1808_6406 YP_001115558.1 two component heavy metal response transcriptional regulator VFG1386 Protein 6e-37 44