Gene Information

Name : Bcep1808_5450 (Bcep1808_5450)
Accession : YP_001117859.1
Strain :
Genome accession: NC_009255
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2405924 - 2406586 bp
Length : 663 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bam:Bamb_4356 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGCGTACTGCTCGTCGAGGACGATCCGCTGATCGGCAGCGGGCTCGAACAGGGCCTCAGACAGGAAGGCTTCGCGGT
CGACTGGGTGAAGGACGGCGACGCCGCGTCGCTCGCGCTGCGCTCGACCGGCTACGGGCTGCTGCTGCTCGACCTCGGGC
TGCCGAACCGCGACGGTCTGTCGGTGCTCGCGGCGCTGCGCCGCCGCGACGAAACGCTGCCCGCGATCATCATCACCGCG
CGCGACGGCGTGCCGGACCGCATCGCCGGCCTCGACAGCGGCGCCGACGACTACCTCGTCAAGCCGTTCGTGCTCGAGGA
GCTGCTCGCGCGCATTCGCGCGGTCACGCGGCGTCACGCCGGGCGCGCGCAGACGACGCTCGCGATCGGCCCGCTGCGGC
TCGATCCGATCAAGCATCTGGTGTGGCTCAACGACGACGAAGTCACGCTGTCGCCGAAGGAGTTCGTGCTGCTGCACGAA
CTGATGCGCGACCCCGGCGCGGTGATTTCGCGCGAACAGTTCGAGGAACGGCTGTACAGCTGGGGCGAGGAGATCGAGAG
CAACGCGGTGCAGGTTCACATCCACAACCTGCGCAAGAAGCTCGGTCATGACATGATCCGCACGGTGCGCGGCGTCGGCT
ACCGGATCGGTGACGGCGCATGA

Protein sequence :
MRVLLVEDDPLIGSGLEQGLRQEGFAVDWVKDGDAASLALRSTGYGLLLLDLGLPNRDGLSVLAALRRRDETLPAIIITA
RDGVPDRIAGLDSGADDYLVKPFVLEELLARIRAVTRRHAGRAQTTLAIGPLRLDPIKHLVWLNDDEVTLSPKEFVLLHE
LMRDPGAVISREQFEERLYSWGEEIESNAVQVHIHNLRKKLGHDMIRTVRGVGYRIGDGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-37 49
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator BAC0487 Protein 5e-32 45
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator BAC0083 Protein 8e-29 42
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator BAC0197 Protein 3e-27 42
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-22 41
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-22 41
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-22 41
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-22 41
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-22 41
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-22 41
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-22 41
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator VFG0473 Protein 1e-39 50
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator VFG1389 Protein 1e-26 42
Bcep1808_5450 YP_001117859.1 two component transcriptional regulator VFG0596 Protein 5e-24 41