Gene Information

Name : Bcep1808_0130 (Bcep1808_0130)
Accession : YP_001117988.1
Strain :
Genome accession: NC_009256
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 145661 - 146092 bp
Length : 432 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: regulatory protein, MerR; KEGG: bur:Bcep18194_A3303 transcriptional regulator, MerR family

DNA sequence :
ATGAAGATCGGCGAACTGGCCAAAGCGGCCCGCTGCACGCCCGAAACGATCCGCTTCTACGAGCGGGAGGGGCTGATGCC
GGATGCGGAGCGCACCGATTCGAACTACCGCAACTACACCGACGTGCACGTCGAACGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGACGAAATCCGCGCGCTGCTGCAACTCACCGACACGCCGGCCGATCCGTGCGATTCGGTC
AATGCACTGCTCGACGAACACATCGGCCACGTCGACGCGCGCCTCGCCGAACTCACGCATCTGCGCGACCAGCTGATCGA
ACTGCGCCGCCAGTGCGTCGGCGAACATTCGGTCGAGGACTGCGGGATCGTCCACGGTCTGACGACCATGGAGACGGTCG
CGCCGCCCGCAAAACGCTCGCACCTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEREGLMPDAERTDSNYRNYTDVHVERLRFIRNCRALDMAHDEIRALLQLTDTPADPCDSV
NALLDEHIGHVDARLAELTHLRDQLIELRRQCVGEHSVEDCGIVHGLTTMETVAPPAKRSHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 5e-32 50
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-30 47
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-30 47
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-30 47
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-30 47
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-30 47
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-30 47
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-30 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_0130 YP_001117988.1 MerR family transcriptional regulator BAC0058 Protein 1e-39 58
Bcep1808_0130 YP_001117988.1 MerR family transcriptional regulator BAC0301 Protein 6e-31 53