Gene Information

Name : Bcep1808_0425 (Bcep1808_0425)
Accession : YP_001118272.1
Strain :
Genome accession: NC_009256
Putative virulence/resistance : Unknown
Product : phage integrase family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 456812 - 458029 bp
Length : 1218 bp
Strand : +
Note : PFAM: phage integrase family protein; KEGG: rso:RSc0968 probable CP4-like integrase protein

DNA sequence :
ATGAAAACCAAACCTCTTACCGACGCCAAGTGCCGCAACGCTAGATTCGATGAGGCCGGGGGGAACAAACTCTTCGACGG
CGGCGGCCTGTATCTCGATCTGCGCTCCAGTGGTTCGAAGAAATGGCGGCTCAAATACCGGTTCAATGGCAAAGAAAACC
TGCTGACGTTCGGCGACTATCCCGCGACATCGCTCGCTGATGCTCGGTCGAGGCGTGACGAAGCGAAGCGGCTGTTAGCG
GAAGGGAAGAACCCTGCGTTCGAGCGTGACGTCGAGAAGCAGACTCGCGCCATTGCCGCACAGAACACCTTCGAGGCCGT
CGCGCTGGAGTGGTACGAGGCGCAGCAAGCGACATGGAGCGCTTCGCACGCGAACCGAGTCAAGAAACAGCTCGATCGCG
AGGTGTTTCCCCTGATCGGCCAGCGCCCGATTTCTTCGATCGGCGCCCCGGATTTGCTCGCGGTCGTTCGACGAATCGAA
GGACGAGAGGCGTTCGAGACGGCGCGCAAGACGTTGCAGACATGCGGCCAAGTCTTTCGCTATGCCGTTGCAACGAGCCG
TGCCGAGCGAGATCCGTCGCCTGACCTGCGAGGCGCATTGAAGGCGGTGCCCGTCAAGCATATGGCGCGAGTCGGCGAAA
GCGAGCTGCCGGAGTTGCTTCGCTCGATCGCCTCCTATGAAGGCGAGCCCGAGACCCGGCTCGCTCTGCGATTCCTGGCA
TTGACGTTCGTTCGCACCATCGAGCTGCGGCAGGCCGAGTGGACGGAGATCGACTTGGAGCGCCGAGAGTGGCGCATTCC
GGCCGAGAAGATGAAGATGCGCCGCGTGCATATCGTGCCGCTCGCCGAGCAGGCGATCGCGCTGCTTTCCGAGCTGCGCG
CGCTGACGGGCCACCGTCGCTGGCTGTTCCCGAACAGCCGCAGACCGTTGCAGCAGATGAGCGAGAACACGATTCTGTAC
GCTCTATACCGGATGGGCTATCGCAGCCGTATGACCGGGCACGGGTTCCGTGGTCTCGCTTCAACGATCTTGAACGAGAA
GGGATTCAATTCCGACTGGATCGAGCGCCAGCTCGCCCACTCGGAGCAGGACGGGGTGCGGGCGGCATACAACCATGCCG
AGTATCTGTCTGAGCGCCATCGAATGATGCAGTGGTGGGCGGACTATCTCGACAAGCAGAGTGGGGCGCAGATCATCCCG
ATCGCGGCGGCAGGATAG

Protein sequence :
MKTKPLTDAKCRNARFDEAGGNKLFDGGGLYLDLRSSGSKKWRLKYRFNGKENLLTFGDYPATSLADARSRRDEAKRLLA
EGKNPAFERDVEKQTRAIAAQNTFEAVALEWYEAQQATWSASHANRVKKQLDREVFPLIGQRPISSIGAPDLLAVVRRIE
GREAFETARKTLQTCGQVFRYAVATSRAERDPSPDLRGALKAVPVKHMARVGESELPELLRSIASYEGEPETRLALRFLA
LTFVRTIELRQAEWTEIDLERREWRIPAEKMKMRRVHIVPLAEQAIALLSELRALTGHRRWLFPNSRRPLQQMSENTILY
ALYRMGYRSRMTGHGFRGLASTILNEKGFNSDWIERQLAHSEQDGVRAAYNHAEYLSERHRMMQWWADYLDKQSGAQIIP
IAAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 5e-86 47
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 1e-85 47
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 1e-83 47
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 1e-83 47
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 8e-84 47
int CAC39282.1 integrase Not tested LPA Protein 2e-85 46
aec33 AAW51716.1 Int Not tested AGI-3 Protein 1e-85 46
int AAD44730.1 Int Not tested SHI-2 Protein 1e-84 46
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 2e-84 46
ECs4534 NP_312561.1 integrase Not tested LEE Protein 2e-84 46
int AAC31482.1 CP4-like integrase Not tested LEE Protein 1e-84 46
int ACU09430.1 integrase Not tested LEE Protein 1e-84 46
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 9e-68 44
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 9e-68 44
intA AAB00935.1 integrase A Not tested vap locus Protein 1e-60 43
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 1e-70 43
int AAK16198.1 Int Not tested PAI-I AL862 Protein 8e-71 43
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 8e-71 43
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 6e-70 43
int AAL51003.1 CP4-like integrase Not tested LEE Protein 5e-70 43
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 5e-70 42
int AAK00456.1 Int Not tested SHI-1 Protein 1e-67 42
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 3e-71 42
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 2e-71 42
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 1e-70 42
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 4e-71 42
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 4e-71 42
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 5e-71 42
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 4e-68 42
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 4e-69 42
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 9e-70 42
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 9e-70 42
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 7e-70 42
int AAL51028.1 CP4-like integrase Not tested LEE Protein 7e-70 42
int-phe AAL60261.1 Int-phe Not tested LEE Protein 7e-70 42
int CAC81896.1 integrase Not tested LEE II Protein 3e-66 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_0425 YP_001118272.1 phage integrase family protein VFG0598 Protein 4e-84 47
Bcep1808_0425 YP_001118272.1 phage integrase family protein VFG0783 Protein 7e-85 46
Bcep1808_0425 YP_001118272.1 phage integrase family protein VFG0626 Protein 2e-71 42
Bcep1808_0425 YP_001118272.1 phage integrase family protein VFG1693 Protein 2e-71 42