Gene Information

Name : Mflv_0035 (Mflv_0035)
Accession : YP_001131319.1
Strain : Mycobacterium gilvum PYR-GCK
Genome accession: NC_009338
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 31941 - 32651 bp
Length : 711 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mkm:Mkms_0723 two component transcriptional regulator, winged helix family

DNA sequence :
GTGGTGACCCGAGTCCTCATCGCCGATGACGATGGCGTCGTCCGCGACGTCGTCCGCCGCTACCTGGAGCGCGACGGACT
CGAGGTGTCCACCGCACACGACGGCAACGAGGCGCTGCGACTGCTCAGTTCGCAGCGCATCGACGTCGCAGTGCTCGACG
TGATGATGCCCGGCCCCGACGGGATGGCGCTGTGCCGACGTCTGCGCCAGAACGGCCACTACTCGGTGCCCGTGATCCTG
CTGACGGCCCTCGGCGAGGAGGACGACCGCATCGCCGGGCTGGAAGCCGGTGCCGACGACTACCTGACCAAACCGTTCAG
CCCGCGTGAGCTGGCGCTGCGCGTCCGGTCGGTGCTGCGACGCTCACCGGCCTCGATCGCGGCCCACCCGGTCGACATCA
CCTCCGGTGACCTGACCGTGTCGACGGCGTCGCGCTCGGCCACCGTCGGCGGCAGGACGGTCAGCCTGACCAATCGCGAG
TTCGACCTGCTGTTGTTCTTCCTGACCCACGCCGGCACCGTCTACACCCGCGAGGACCTCCTCAAAGAGGTGTGGCACTG
GGATTTCGGCGACCTGTCCACGGTCACCGTGCATGTGAAGCGACTGCGCTCCAAGCTCGGTGACCGGCACCGGGTACAGA
CCGTGTGGGGCCGCGGCTACATGTGGGCCCCCGACGAAGCGTCGCCCGGGCAGCCGGATGCTGCCGGCTGA

Protein sequence :
MVTRVLIADDDGVVRDVVRRYLERDGLEVSTAHDGNEALRLLSSQRIDVAVLDVMMPGPDGMALCRRLRQNGHYSVPVIL
LTALGEEDDRIAGLEAGADDYLTKPFSPRELALRVRSVLRRSPASIAAHPVDITSGDLTVSTASRSATVGGRTVSLTNRE
FDLLLFFLTHAGTVYTREDLLKEVWHWDFGDLSTVTVHVKRLRSKLGDRHRVQTVWGRGYMWAPDEASPGQPDAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-30 43
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-30 42
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-30 42
Mflv_0035 YP_001131319.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-28 42
Mflv_0035 YP_001131319.1 two component transcriptional regulator CP001485.1.gene721.p Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mflv_0035 YP_001131319.1 two component transcriptional regulator VFG1389 Protein 1e-26 45
Mflv_0035 YP_001131319.1 two component transcriptional regulator VFG1390 Protein 8e-28 43