Gene Information

Name : Mflv_5443 (Mflv_5443)
Accession : YP_001136692.1
Strain :
Genome accession: NC_009339
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 180868 - 181194 bp
Length : 327 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: msm:MSMEG_2676 IS1137, transposase orfA

DNA sequence :
GTGGGAACGAAGTCATCGAAGCGGTATCCAGACGAGCTGAAGGCGCGAGCGGTGCAGATGGTGGCCGATCTGCGCAGCGA
CACGGTCTCGGAGTGGGAGGCGATGGGCCGGGTTGCTGATCTGCTGGGCGTCGGTACCGCCGAGACGGTGCGCAAATGGG
TCCGCCAGGCCGAGATCGACGCCGGAGATCGGGCTGGGCAGACCAGCGAGGAATCCGAGGTCCTGCGCAAGCTGCGCCGG
GAGAACGCCGAACTCAAGCGGGCCAACGCGATTTTGAAGGCGGCGTCGGTTTTCTTCGCTGCCGAGCTCGACCGGCCGTC
TCAGTAG

Protein sequence :
MGTKSSKRYPDELKARAVQMVADLRSDTVSEWEAMGRVADLLGVGTAETVRKWVRQAEIDAGDRAGQTSEESEVLRKLRR
ENAELKRANAILKAASVFFAAELDRPSQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 9e-13 45
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 9e-13 45
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 9e-13 45
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-11 45
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-11 45
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 3e-11 45
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 9e-13 45
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-10 44
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-10 44
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 2e-10 44
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-10 44
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 2e-10 44
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 9e-13 44
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 9e-13 44
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 9e-13 44
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 9e-13 44
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 1e-12 44
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-10 44
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 7e-10 44
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 5e-09 44
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 7e-09 44
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 2e-10 43
unnamed AAF09023.1 unknown Not tested SHI-O Protein 2e-10 43
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-08 42
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-08 42
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 3e-08 42
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 4e-08 42
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 3e-08 42
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 1e-08 42
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 2e-09 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mflv_5443 YP_001136692.1 transposase IS3/IS911 family protein VFG0643 Protein 7e-11 44
Mflv_5443 YP_001136692.1 transposase IS3/IS911 family protein VFG1603 Protein 3e-10 44
Mflv_5443 YP_001136692.1 transposase IS3/IS911 family protein VFG0606 Protein 7e-10 42
Mflv_5443 YP_001136692.1 transposase IS3/IS911 family protein VFG1717 Protein 1e-08 42