Gene Information

Name : Rsph17025_3762 (Rsph17025_3762)
Accession : YP_001169931.1
Strain :
Genome accession: NC_009429
Putative virulence/resistance : Unknown
Product : transposase IS66
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 665463 - 665816 bp
Length : 354 bp
Strand : +
Note : PFAM: transposase IS66

DNA sequence :
GTGATCCTGCCGGGCGGGATCAACCGGGCCTATCTGGCGACGCGGCCGGTCGATTTCAGGAAGGGACACGCGGGCCTCGC
GCTGATCGTGCAGAGCGTGCTGGGCCACGATCCCTACAACGGCGCGATCTACCTGTTCCGCTCGAAGCGTGGCGACCAGT
TGAAGTGCCTGGTTTGGGATCAGACCGGCCTCGTTCTGATCTACAAGAAGCTCGAGGGCGGCGCCTTCCACTGGCCGAAG
CCGGCCGACGGGGTGATCCGGCTGTCGCCGGCGCAGTTCTCGGCTCTTGTCGAAGGGCTGGACTGGCGAGCGGTCCGGGC
CGAGCGGCGGCCGCGGCCAAGGCTGGCGGGATAG

Protein sequence :
MILPGGINRAYLATRPVDFRKGHAGLALIVQSVLGHDPYNGAIYLFRSKRGDQLKCLVWDQTGLVLIYKKLEGGAFHWPK
PADGVIRLSPAQFSALVEGLDWRAVRAERRPRPRLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-19 49
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-16 48
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-16 48
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-16 47
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-14 44
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-14 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-14 43
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 9e-14 43
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 9e-14 43
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-13 43
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 9e-14 43
unnamed AAC31493.1 L0014 Not tested LEE Protein 7e-14 43
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 7e-14 43
unnamed AAL99258.1 unknown Not tested LEE Protein 7e-14 43
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 7e-14 43
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-15 42
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-15 42
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-15 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-13 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-13 42
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-10 41
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-13 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-13 41
tnpB AEZ06052.1 transposition helper protein Not tested Tn6167 Protein 6e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rsph17025_3762 YP_001169931.1 transposase IS66 VFG1665 Protein 9e-17 47
Rsph17025_3762 YP_001169931.1 transposase IS66 VFG1698 Protein 6e-15 44
Rsph17025_3762 YP_001169931.1 transposase IS66 VFG1052 Protein 4e-14 43
Rsph17025_3762 YP_001169931.1 transposase IS66 VFG1709 Protein 3e-14 43
Rsph17025_3762 YP_001169931.1 transposase IS66 VFG0792 Protein 3e-14 43
Rsph17025_3762 YP_001169931.1 transposase IS66 VFG1737 Protein 2e-15 42
Rsph17025_3762 YP_001169931.1 transposase IS66 VFG1517 Protein 2e-10 41