Gene Information

Name : PST_2171 (PST_2171)
Accession : YP_001172676.1
Strain : Pseudomonas stutzeri A1501
Genome accession: NC_009434
Putative virulence/resistance : Resistance
Product : aminoglycoside resistance protein
Function : -
COG functional category : R : General function prediction only
COG ID : COG1708
EC number : -
Position : 2361376 - 2362164 bp
Length : 789 bp
Strand : +
Note : streptomycin 3'-adenyltransferase

DNA sequence :
ATGAACCCATCCGTGTCCAGCCAGCTGCAGCAGGCACTGGCGCTGCTGCAGCGTCACCTGGGCGGGAACCTGCTGGCCGT
GCATCTGTTCGGCTCGGCCGTTGTCGGTGGCCTGAAACCCGGCAGCGATCTCGACCTGCTCGTTACCGTCGCCGCCCCCC
TGCCGACAGCCACGCGCCACTCGCTGATGCGCGAGCTGCTGATGATTTCCGCCTGGCCGGCCAACGAGCGAATGCGCCCG
CTGGAAGTCACCTGGGTGGTACATCACTCGGTACGGCCCTGGCGTTATCCGGCAATGCGCGAATTGCAATTCGGCGAATG
GCTGCGCGCCGATATCGAAGCCGGCCGCATCGAGCCGCCCCAGGAGGACCACGATCTGGCCATTCTGCTGCACCAGGCGC
GCACGAACGGCGCCTGTCTGATCGGCCCTGGCGCGGCCGAATTGTTCGACCCGGTGCCCGAGGAGGACATGCGCCAAGCC
TTGCGCGACACGCTGGCGCAATGGCGCGAGCCCGCCGACTGGCAGGGAGACGAGTGCAACGTGGTGTTGGCCGTGGCGCG
CATCTGGCTCACCCTGACCACGGACGCCATCGCGCCGAAGGACGTCGCAGCGATCTGGCTGCTCGAGCGTCTGCCGGATG
AGCACCGTGCCGTGCTGGAGAAAGCCAGCCAGGCCTATCGGGGCGACGCGATCGAAAAGCCTGCCCTGAGCCCACAGGCG
GTGGAGGCGTTCATCCGGCATGCGCAAACGCAGTTGCAGCCGTCGCAACCAACAGGAGCAGAGCGATGA

Protein sequence :
MNPSVSSQLQQALALLQRHLGGNLLAVHLFGSAVVGGLKPGSDLDLLVTVAAPLPTATRHSLMRELLMISAWPANERMRP
LEVTWVVHHSVRPWRYPAMRELQFGEWLRADIEAGRIEPPQEDHDLAILLHQARTNGACLIGPGAAELFDPVPEEDMRQA
LRDTLAQWREPADWQGDECNVVLAVARIWLTLTTDAIAPKDVAAIWLLERLPDEHRAVLEKASQAYRGDAIEKPALSPQA
VEAFIRHAQTQLQPSQPTGAER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 8e-58 55
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 8e-58 55
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 8e-58 55
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 9e-58 54
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 1e-57 54
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 9e-58 54
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 9e-58 54
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 9e-58 54
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 2e-58 54
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 7e-58 54
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 7e-58 54
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 7e-58 54
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 7e-58 54
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 1e-57 54
aadA7 AAR21854.1 aminoglycoside (3'')(9) adenylyltransferase; AAD(3'')(9) Not tested SGI1 Protein 5e-56 54
aadA7 AAT37846.1 aminoglycoside adenyltransferase Not tested Class I integron Protein 5e-56 54
aadA7 AGF35062.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-56 54
aadA7 AGK06932.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-56 54
aadA7 AGK06969.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-56 54
aadA7 AGK07015.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-56 54
aadA7 AGK07073.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-56 54
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 5e-58 54
aadA1 AAL08435.1 streptomycin adenyltransferase AadA1 Not tested SRL Protein 1e-54 52
spc1 YP_039523.1 streptomycin 3''-adenylyltransferase 1 Not tested Type-II SCCmec Protein 3e-42 43
ant(9) BAC57473.1 O-nucleotidyltransferase(9) Not tested Type-IIIinv SCCmec Protein 2e-42 43
ant(9) NP_370577.1 O-nucleotidylltransferase Not tested Type-II SCCmec Protein 3e-42 43
spc BAA82204.1 O-nucleotydiltransferase(9) Not tested Type-II SCCmec Protein 2e-42 43
ant(9) NP_373289.1 O-nucleotidylltransferase(9) Not tested Type-II SCCmec Protein 3e-42 43
spC YP_190051.1 streptomycin 3''-adenylyltransferase Not tested Type-II SCCmec Protein 3e-42 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PST_2171 YP_001172676.1 aminoglycoside resistance protein EU118119.1.orf1.gene Protein 5e-58 55
PST_2171 YP_001172676.1 aminoglycoside resistance protein AJ704863.gene12.p01 Protein 8e-56 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AY139598.1.gene2.p01 Protein 2e-54 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_010558.1.6275994. Protein 5e-55 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein DQ865198.gene.p01 Protein 5e-55 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AJ584652.2.gene7.p01 Protein 4e-57 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein FR748153.1.gene5.p01 Protein 7e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AY263741.gene.p01 Protein 3e-56 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AF313471.1.gene3.p01 Protein 4e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AY339625.2.gene17.p0 Protein 4e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AF047479.2.orf1.gene Protein 8e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein Y18050.2.gene6.p01 Protein 7e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AY123251.gene3.p01 Protein 4e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_010410.6003168.p0 Protein 4e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein JN596991.2.gene3.p01 Protein 7e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_010410.6003170.p0 Protein 3e-58 54
PST_2171 YP_001172676.1 aminoglycoside resistance protein AM932669.1.gene3.p01 Protein 2e-58 53
PST_2171 YP_001172676.1 aminoglycoside resistance protein AF294653.1.gene3.p01 Protein 1e-57 53
PST_2171 YP_001172676.1 aminoglycoside resistance protein AF174129.3.gene3.p01 Protein 1e-57 53
PST_2171 YP_001172676.1 aminoglycoside resistance protein U37105.2.gene4.p01 Protein 3e-55 53
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_003198.gene.p01 Protein 7e-41 47
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_009782.5559472.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002758.1120013.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002952.2859153.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002745.1122823.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002745.1124325.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002745.1125314.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein GU235985.1.orf1.gene Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_009782.5559439.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002758.1121631.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002952.2859154.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002745.1123578.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_002745.1124853.p0 Protein 1e-42 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_010400.5986843.p0 Protein 9e-34 43
PST_2171 YP_001172676.1 aminoglycoside resistance protein NC_010410.6002671.p0 Protein 2e-33 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PST_2171 YP_001172676.1 aminoglycoside resistance protein VFG1026 Protein 6e-55 52