Gene Information

Name : Ent638_0477 (Ent638_0477)
Accession : YP_001175216.1
Strain : Enterobacter sp. 638
Genome accession: NC_009436
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 542994 - 543314 bp
Length : 321 bp
Strand : +
Note : PFAM: protein of unknown function DUF1219; KEGG: ecj:JW2627 toxin of the YpjF-YfjZ toxin-antitoxin system

DNA sequence :
ATGCACATTTCTCCTGTACCGGCTACGGTGCCGGTTTTGTCACGCCTGTCGCCCGTACAGGTGTGGCAGCAACTGTTAAC
GTATCTGCTGGAACATCATTACGGCCTAACACTTAACGACACGCCATTCCACGACGACGCGGCCATTCAGGAACATATCG
AGGCGGGAATAACGCTTGCCGATGCGGTGAATTTCTTGGTGGAACGTTATGAACTGGTACGCATCGACCGCAAAGGATTT
ACATGGCAGGAGCAGACACCATTCCTGACCGCGACTGATATTCTCAAAGCCAAGCGAGCTACCGGATTAATAAATACTTG
A

Protein sequence :
MHISPVPATVPVLSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDAAIQEHIEAGITLADAVNFLVERYELVRIDRKGF
TWQEQTPFLTATDILKAKRATGLINT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 3e-25 62
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-24 61
unnamed AAL57575.1 unknown Not tested LEE Protein 1e-24 61
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 2e-24 61
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-24 61
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 2e-24 61
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-24 61
unnamed AAL08478.1 unknown Not tested SRL Protein 1e-23 60
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 6e-24 60
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 6e-24 60
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 6e-24 60
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 2e-24 60
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 3e-24 60
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 3e-24 60
unnamed AAC31486.1 L0007 Not tested LEE Protein 1e-23 59
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 2e-23 59
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 1e-23 59
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 2e-23 59
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 3e-23 59
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 2e-23 59
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-23 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_0477 YP_001175216.1 hypothetical protein VFG1682 Protein 1e-25 62
Ent638_0477 YP_001175216.1 hypothetical protein VFG1620 Protein 9e-25 61
Ent638_0477 YP_001175216.1 hypothetical protein VFG1069 Protein 5e-24 60
Ent638_0477 YP_001175216.1 hypothetical protein VFG1530 Protein 2e-24 60
Ent638_0477 YP_001175216.1 hypothetical protein VFG0663 Protein 7e-25 60
Ent638_0477 YP_001175216.1 hypothetical protein VFG0786 Protein 5e-24 59