Gene Information

Name : BRADO6209 (BRADO6209)
Accession : YP_001208071.1
Strain : Bradyrhizobium sp. ORS278
Genome accession: NC_009445
Putative virulence/resistance : Virulence
Product : prophage CP4-57 regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 6446753 - 6446968 bp
Length : 216 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 7511582; Product type pr : regulator

DNA sequence :
ATGCGCGAACCAGATCGTATCATCCGCTTGAGAACCGTCCTCGCCAGGACCGGACTGTCTCGATCTACCATCTACCGCAA
GATCGCCGAAGGCACGTTCCCGGCCCCGCTCAAAATCAGCACCAACGGCTCGGGCTGGCACGACTCCGAAATCAACAGCT
GGATAGCGGATCCAGTTGGATGGCGTCCGCGTCGCGACCTCGATGAGGTCCGGTGA

Protein sequence :
MREPDRIIRLRTVLARTGLSRSTIYRKIAEGTFPAPLKISTNGSGWHDSEINSWIADPVGWRPRRDLDEVR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 3e-09 43
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 1e-07 42
unnamed CAA21398.1 - Not tested HPI Protein 1e-07 42
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 4e-09 42
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 4e-09 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BRADO6209 YP_001208071.1 prophage CP4-57 regulator VFG1141 Protein 1e-09 42