Gene Information

Name : Acry_3106 (Acry_3106)
Accession : YP_001219877.1
Strain :
Genome accession: NC_009467
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2212 - 2889 bp
Length : 678 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAGGGTTCTTATCGTCGAGGACGAGGCGAAGACCGCGGCTTATCTCCGAAAGGGTCTCGAAGAGAACGGCTTCACGGC
GGATGTGGCTACTGATGGAGAGACGGGGCTCGAATTCGCCCGCCACGGCGGCTACGATGCCATTATTCTCGACATCATGC
TGCCACGGCGCAACGGCTTCGAAATCCTCGACGAAATCCGGCGGCGAGACAGTCAGACCGCCGTGCTTCTACTCACGGCG
CGGGACCAGGTGACAGATCGCGTCGCCGGGCTGGAGGCCGGGGCTGACGATTACCTCGTCAAGCCCTTCGCGTTTTCCGA
GCTGCTTGCCCGTGTGCGCACCATTCTGCGGCGAGGGCACGCGCGGCAACCGGCGCTGATCCAGATCGCCGATCTCGAGA
TCGACCTCTCGGGACACCGGGCAACGCGAGCGGGTCAGGCGCTCGATCTGACGCCGAAGGAGTTCCGCCTGCTTTCGTTG
TTGGCCCGCCGCGCGGGCGATGTCATCTCCCGAACGGTCATTGCCGAACAGGTCTGGGACATCAATTTCGATTCTGGCAC
GAACGTCGTCGACGTCCACATGTACCGCCTCCGCGCCAAGCTGGACGACCCGTTCTCCCGCCGCCTGATCCACACCGTTC
GTGGCGTGGGTTACGTGCTCGAAGACTGTGGCGGCTGA

Protein sequence :
MRVLIVEDEAKTAAYLRKGLEENGFTADVATDGETGLEFARHGGYDAIILDIMLPRRNGFEILDEIRRRDSQTAVLLLTA
RDQVTDRVAGLEAGADDYLVKPFAFSELLARVRTILRRGHARQPALIQIADLEIDLSGHRATRAGQALDLTPKEFRLLSL
LARRAGDVISRTVIAEQVWDINFDSGTNVVDVHMYRLRAKLDDPFSRRLIHTVRGVGYVLEDCGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-51 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-51 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator BAC0197 Protein 1e-62 62
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator BAC0125 Protein 3e-60 58
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-55 55
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-55 55
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator BAC0638 Protein 3e-50 54
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator BAC0308 Protein 4e-55 53
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-49 51
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-37 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 5e-33 45
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-34 43
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 1e-31 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 1e-30 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 5e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 7e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 3e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 7e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 7e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 7e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 4e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 7e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 7e-36 41
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 7e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator VFG0596 Protein 5e-52 53
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-37 47
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator VFG1390 Protein 4e-39 42
Acry_3106 YP_001219877.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-37 42