Gene Information

Name : SynWH7803_2248 (SynWH7803_2248)
Accession : YP_001225971.1
Strain : Synechococcus sp. WH 7803
Genome accession: NC_009481
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2073522 - 2074268 bp
Length : 747 bp
Strand : +
Note : -

DNA sequence :
ATGACGGCCTCAGCCCCTACCAAGGAAACCATTCTCGTAGTGGACGACGAGGCCAGTATCCGCAGGATCCTGGAAACCCG
CCTCTCGATGATCGGCTACAACGTCGTCACCGCTTGCGATGGCACGGAGGCCCTGGAGTGTTTCCAGGAGTGCGAGCCGG
ATTTGGTCGTGCTCGACGTGATGATGCCGAAGCTTGATGGCTACGGGGTCTGTCAGGAGCTGCGCAAGGAATCGGATGTG
CCGATCGTGATGCTCACTGCGTTGGGTGACGTGGCTGACCGCATCACCGGGCTGGAGCTGGGAGCCGACGATTACGTGAT
CAAGCCCTTCAGCCCCAAAGAATTGGAGGCCCGAATCCGCTGCGTGTTGCGCAGGGTGGAGAAAGAACACGCTGCCGGTA
TCCCCAACACCGGCTTGATCAAGGTGTCGGATCTCAAGATCGACACCAACAAACGCCAAGTGTTCCGGGCCGATGAACGC
ATCCGCCTCACAGGAATGGAATTCAGCTTGCTTGAACTGTTGGTGAGCCGCTCAGGCGAACCCTTCAGCCGTGGTGAGAT
TCTGAAGGAGGTCTGGGGGTACACCCCAGAACGACACGTGGATACCCGCGTGGTGGATGTTCATATTTCCCGTCTTCGTT
CCAAACTGGAAGACGACCCGGCCAATCCCGAGCTGATCCTCACAGCCCGAGGAACCGGTTACCTGTTCCAGCGCATCGTC
GATTCCGTTGCCTCCGAAGGACCCTGA

Protein sequence :
MTASAPTKETILVVDDEASIRRILETRLSMIGYNVVTACDGTEALECFQECEPDLVVLDVMMPKLDGYGVCQELRKESDV
PIVMLTALGDVADRITGLELGADDYVIKPFSPKELEARIRCVLRRVEKEHAAGIPNTGLIKVSDLKIDTNKRQVFRADER
IRLTGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPANPELILTARGTGYLFQRIV
DSVASEGP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SynWH7803_2248 YP_001225971.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-41 48
SynWH7803_2248 YP_001225971.1 two-component system response regulator BAC0125 Protein 2e-39 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_002952.2859905.p0 Protein 8e-45 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_007622.3794472.p0 Protein 9e-45 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-44 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator HE999704.1.gene2815. Protein 5e-40 47
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-42 46
SynWH7803_2248 YP_001225971.1 two-component system response regulator BAC0638 Protein 2e-29 43
SynWH7803_2248 YP_001225971.1 two-component system response regulator CP000034.1.gene3671. Protein 9e-38 43
SynWH7803_2248 YP_001225971.1 two-component system response regulator BAC0308 Protein 2e-35 42
SynWH7803_2248 YP_001225971.1 two-component system response regulator BAC0083 Protein 9e-35 42
SynWH7803_2248 YP_001225971.1 two-component system response regulator BAC0197 Protein 7e-35 42
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-35 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator CP001918.1.gene5135. Protein 8e-25 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator HE999704.1.gene1528. Protein 7e-30 41
SynWH7803_2248 YP_001225971.1 two-component system response regulator NC_012469.1.7686381. Protein 1e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SynWH7803_2248 YP_001225971.1 two-component system response regulator VFG1390 Protein 3e-39 45
SynWH7803_2248 YP_001225971.1 two-component system response regulator VFG0596 Protein 6e-32 42
SynWH7803_2248 YP_001225971.1 two-component system response regulator VFG1389 Protein 9e-32 42