
|
Name : fliQ (BBta_5494) Accession : YP_001241362.1 Strain : Bradyrhizobium sp. BTAi1 Genome accession: NC_009485 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 5712103 - 5712366 bp Length : 264 bp Strand : - Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum DNA sequence : ATGACCGGGGCTGAAACGCTCGACGTGGCGCGCGATGCGATCTGGACCATCGTGCTGGTGTCGTCGCCGCTGATGGTGGT CGGACTCGTGGTGGGCGTGGTCGTGTCGCTGTTCCAGGCGCTGACGCAGATCCAGGAGCAGACGCTGGTGTTCGTGCCGA AGATCATCGCGATCTTCGTGACGCTGCTGCTGGCCCTGCCGTTCATGGCCGATGCGCTGCATTCGCACATGATGCGGATC TCGTCGCGAATCATCGGCGGATGA Protein sequence : MTGAETLDVARDAIWTIVLVSSPLMVVGLVVGVVVSLFQALTQIQEQTLVFVPKIIAIFVTLLLALPFMADALHSHMMRI SSRIIGG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 0.001 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| fliQ | YP_001241362.1 | flagellar biosynthesis protein FliQ | VFG0395 | Protein | 1e-04 | 44 |