Gene Information

Name : SaurJH9_0024 (SaurJH9_0024)
Accession : YP_001245414.1
Strain : Staphylococcus aureus JH9
Genome accession: NC_009487
Putative virulence/resistance : Unknown
Product : rRNA large subunit methyltransferase
Function : -
COG functional category : S : Function unknown
COG ID : COG1576
EC number : -
Position : 33747 - 34226 bp
Length : 480 bp
Strand : +
Note : SPOUT methyltransferase family protein; crystal structure shows homodimer; in Escherichia coli this protein methylates pseudouridine at position 1915 of the 23S ribosomal RNA

DNA sequence :
ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATAGCAGAATATGAAAAACGTTT
AGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGACGAAAAAGCACCAGAAAATATGAGCGACAAAGAAATTGAGC
AAGTAAAAGAAAAAGAAGGCCAACGAATACTAGCCAAAATTAAACCACAATCCACAGTCATTACATTAGAAATACAAGGA
AAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAAAGCGACTTTGTATTCGTCAT
TGGCGGATCAAACGGCCTGCACAAGGACGTCTTACAACGCAGTAACTACGCACTATCATTCAGCAAAATGACATTCCCAC
ATCAAATGATGCGGGTTGTGTTAATTGAGCAAGTGTATAGAGCATTTAAGATTATGCGTGGAGAAGCATATCATAAATGA

Protein sequence :
MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQG
KMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAB72138.1 open reading frame X Not tested Type-IVb SCCmec Protein 2e-72 100
unnamed BAC67575.1 open reading frame X Not tested Type-IVc SCCmec Protein 2e-72 100
unnamed BAA82243.1 orfX Not tested Type-II SCCmec Protein 2e-72 100
unnamed BAD24821.1 conserved hypothetical protein orfX Not tested Type-V SCCmec Protein 2e-72 100
orfX BAA86653.1 open reading frame X Not tested Type-I SCCmec Protein 2e-72 100
unnamed BAG06184.1 conserved hypothetical protein orfX Not tested Type-VII SCCmec Protein 2e-72 100
unnamed BAB47681.1 open reading frame X Not tested Type-III SCCmec Protein 2e-72 100
unnamed BAC53844.1 open reading frame X Not tested SRImec-III and SCCmec-III region Protein 2e-72 100
unnamed BAC57492.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-72 100
SAR0024 YP_039501.1 rRNA large subunit methyltransferase Not tested Type-II SCCmec Protein 3e-72 100
unnamed BAB72121.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-72 100
SAV0024 NP_370548.1 rRNA large subunit methyltransferase Not tested Type-II SCCmec Protein 3e-72 100
orfX AAL26648.1 unknown Not tested SCCcap1 Protein 5e-71 99
orfXhom BAB83497.1 open reading frame X Not tested SCC 12263 Protein 1e-63 92
SE0023 NP_763578.1 rRNA large subunit methyltransferase Not tested SCCpbp4 Protein 2e-68 92
SERP2529 YP_190070.1 rRNA large subunit methyltransferase Not tested Type-II SCCmec Protein 2e-68 92
orfX YP_251938.1 rRNA large subunit methyltransferase Not tested SCCmec Protein 4e-69 92
SSP0026 YP_300116.1 rRNA large subunit methyltransferase Not tested SCC15305RM Protein 1e-66 87
unnamed ACL99851.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-45 86