Gene Information

Name : SaurJH9_0045 (SaurJH9_0045)
Accession : YP_001245433.1
Strain : Staphylococcus aureus JH9
Genome accession: NC_009487
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG4333
EC number : -
Position : 55281 - 55787 bp
Length : 507 bp
Strand : -
Note : PFAM: protein of unknown function DUF1643

DNA sequence :
ATGAATACAATCAAAAATACGATATACACAGAAGCTATATTTAGCAAGGATGAAAAACACCGCTATTTACTCAAGAAAAC
ATGGGATGAAAAGAAACCCGCTTGTACAGTGATAACGATGTACCCTCATTTAGATGGTGTATTATCACTCGATCTCACAA
CTGTTCTTATCCTCAATCAATTAGCGAATTCAGAACGATACGGTGCTGTATATCTTGTAAATCTATTCTCTAATATTAAA
ACACCAGAGAACCTTAAACATATTAAAGAACCTTATGATAAACACACAGACATCCACTTGATGAAAGCAATTAGCGAAAG
TGACACAGTGATTCTAGCTTATGGTGCTTATGCGAAGCGGCCAGTTGTTGTAGAACGTGTCGAACAAGTAATGGAAATGT
TGAAGCCTCATAAAAAGAAAGTCAAAAAGCTCATTAATCCAGCCACAAATGAAATCATGCACCCACTCAACCCTAAAGCA
CGTCAAAAATGGACTTTGAAAGCATAA

Protein sequence :
MNTIKNTIYTEAIFSKDEKHRYLLKKTWDEKKPACTVITMYPHLDGVLSLDLTTVLILNQLANSERYGAVYLVNLFSNIK
TPENLKHIKEPYDKHTDIHLMKAISESDTVILAYGAYAKRPVVVERVEQVMEMLKPHKKKVKKLINPATNEIMHPLNPKA
RQKWTLKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAA94663.1 - Not tested Type-II SCCmec Protein 7e-63 100
SAR0056 YP_039527.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-62 100
SERP2504 YP_190046.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-62 100
SAV0058 NP_370582.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-62 100
SA0054 NP_373294.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-62 100
SH0059 YP_251974.1 hypothetical protein Not tested SCCmec Protein 2e-61 98
unnamed BAG06215.2 hypothetical protein Not tested Type-VII SCCmec Protein 1e-60 98
unnamed ACL99847.1 hypothetical protein Not tested Type-V SCCmec Protein 9e-60 96
SAS0029 YP_042162.1 hypothetical protein Not tested SCC476 Protein 8e-60 95
SAPIG0053 YP_005732863.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-51 95
unnamed BAD24838.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-59 93
MW0035 NP_644850.1 hypothetical protein Not tested Type-IV SCCmec Protein 4e-59 93
SAUSA300_0036 YP_492756.1 hypothetical protein Not tested Type-IV SCCmec Protein 4e-59 93
unnamed BAC67564.1 hypothetical protein Not tested Type-IVc SCCmec Protein 3e-59 93
unnamed BAB72112.1 hypothetical protein Not tested Type-IVa SCCmec Protein 3e-59 93
SAMSHR1132_00360 YP_005324560.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 4e-59 93
unnamed BAB72131.1 hypothetical protein Not tested Type-IVb SCCmec Protein 3e-59 93
SE0030 NP_763585.1 hypothetical protein Not tested SCCpbp4 Protein 3e-59 93
SACOL0037 YP_184948.1 hypothetical protein Not tested Type-I SCCmec Protein 7e-59 92
unnamed BAA94331.1 hypothetical protein Not tested Type-I SCCmec Protein 5e-59 92
SARLGA251_00330 YP_005754048.1 hypothetical protein Not tested Type-XI SCCmec Protein 6e-43 68
unnamed BAB46979.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 7e-42 67
unnamed BAB47669.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-42 67
unnamed BAC53831.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 3e-42 67
SAPIG0037 YP_005732847.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-42 66
unnamed ACL99835.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-42 66
unnamed BAG06194.1 hypothetical protein Not tested Type-VII SCCmec Protein 1e-42 66
SSP0031 YP_300121.1 hypothetical protein Not tested SCC15305RM Protein 3e-38 65
SSP0049 YP_300139.1 hypothetical protein Not tested SCC15305cap Protein 1e-36 62
unnamed BAB47602.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-39 62
unnamed BAB46974.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-39 62