Gene Information

Name : Swit_4916 (Swit_4916)
Accession : YP_001260304.1
Strain :
Genome accession: NC_009508
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 27567 - 27914 bp
Length : 348 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein

DNA sequence :
ATGATCCCGCTGCCGCCCTCAACGCGGATATTCCTGGCCTGCGGCGCAACAGATATGCGTAAGGGTTTTGACGGCCTGGC
TGTGATGACGCAGCAAGTTCTGGAGCAGAGCCCGCATTCCGGTGCGCTGTTCGCCTTTCGAGGGAAGCGCGGTGATCTGG
TAAAGCTGCTCTGGTATGACGGTCAGGGCATGTGCCTTTTCTCCAAGCGGATGGACCGAGGCCGGTTCATTTGGCCATCG
ACCAAGACCGGTTCGGTGGTGATGACGGCGGCCCAGCTTTCCATGCTTCTGGAAGGCATCGACTGGCGGCGGCCGGAACG
CACTTTCACCCCGTCACTCGCGGGCTAA

Protein sequence :
MIPLPPSTRIFLACGATDMRKGFDGLAVMTQQVLEQSPHSGALFAFRGKRGDLVKLLWYDGQGMCLFSKRMDRGRFIWPS
TKTGSVVMTAAQLSMLLEGIDWRRPERTFTPSLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-32 61
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-32 61
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-32 60
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-26 58
unnamed AAC31493.1 L0014 Not tested LEE Protein 9e-31 58
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-30 58
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 9e-31 58
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-30 58
unnamed AAL99258.1 unknown Not tested LEE Protein 9e-31 58
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-30 58
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 9e-31 58
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-30 58
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-29 58
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-31 58
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-29 58
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-31 58
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-30 57
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-21 56
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-29 56
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-29 56
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-30 52
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-30 52
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-29 52
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-29 52
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-30 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_4916 YP_001260304.1 IS66 Orf2 family protein VFG1665 Protein 1e-32 60
Swit_4916 YP_001260304.1 IS66 Orf2 family protein VFG0792 Protein 4e-31 58
Swit_4916 YP_001260304.1 IS66 Orf2 family protein VFG1698 Protein 3e-31 58
Swit_4916 YP_001260304.1 IS66 Orf2 family protein VFG1709 Protein 4e-31 58
Swit_4916 YP_001260304.1 IS66 Orf2 family protein VFG1052 Protein 7e-31 57
Swit_4916 YP_001260304.1 IS66 Orf2 family protein VFG1517 Protein 5e-22 56
Swit_4916 YP_001260304.1 IS66 Orf2 family protein VFG1737 Protein 1e-30 51