Gene Information

Name : Pput_2315 (Pput_2315)
Accession : YP_001267638.1
Strain : Pseudomonas putida F1
Genome accession: NC_009512
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2637605 - 2638306 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCCGAATATTTTCCTGGTCGAAGACGACAGCGCCCTGTCCGAGCTGATCGCCAGCTACCTGCAACGCAACGACTTCCA
TGTCCAGGTGATCGCCCGGGGCGATCATGTGCTGGACGAGTACCGTCGGCAAAGGCCTGACCTGGTCATCCTTGATCTGA
TGCTGCCGGGCATCGATGGCCTGCAGCTGTGCCGGCTGCTGCGCCAGGAGTCGCAGACCCTGCCAATCCTCATGCTGACG
GCCCGCGACGACAGCCATGACCAGGTGCTTGGCCTGGAAATGGGGGCCGACGACTACGTGACCAAACCCTGTGAGCCACG
CGTGCTGCTGGCCCGCGTGCGCACGCTGCTGCGCCGCAGCAGTGTCAACGAACCGCGCCTGGAAAACGACCTGATCCTGA
TTGGTGGCCTGCGCATCGACCTGGCCGAGCGCACGGTGAGTTGGCGCGGCGAGGAGGTGGAGCTGTCCAGCGGCGAGTAC
AACCTGCTGGTGGTGTTGGCGCGCAATGCCGGTGAGGTGATGAACCGCGACCGTATCCTGCAACAACTGCGCGGCATCGA
GTTCAATGGCACCGATCGCTCCGTTGACGTGGCCATTTCCAAACTGCGGCGCAAGTTCGACGACAACGCCGGCGAAGCGC
GCAAGATCAAGACCGTGTGGGGCAAGGGCTACCTGTTCAGCCGTGTCGAGTGGGAGTGCTGA

Protein sequence :
MPNIFLVEDDSALSELIASYLQRNDFHVQVIARGDHVLDEYRRQRPDLVILDLMLPGIDGLQLCRLLRQESQTLPILMLT
ARDDSHDQVLGLEMGADDYVTKPCEPRVLLARVRTLLRRSSVNEPRLENDLILIGGLRIDLAERTVSWRGEEVELSSGEY
NLLVVLARNAGEVMNRDRILQQLRGIEFNGTDRSVDVAISKLRRKFDDNAGEARKIKTVWGKGYLFSRVEWEC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-17 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pput_2315 YP_001267638.1 two component transcriptional regulator AE000516.2.gene3505. Protein 7e-33 43
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-28 42
Pput_2315 YP_001267638.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-34 41
Pput_2315 YP_001267638.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-31 41
Pput_2315 YP_001267638.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-31 41
Pput_2315 YP_001267638.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-30 41
Pput_2315 YP_001267638.1 two component transcriptional regulator BAC0039 Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pput_2315 YP_001267638.1 two component transcriptional regulator VFG0596 Protein 2e-17 41