Gene Information

Name : Pput_4283 (Pput_4283)
Accession : YP_001269591.1
Strain : Pseudomonas putida F1
Genome accession: NC_009512
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4792079 - 4792753 bp
Length : 675 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCGCCTACTGATCATTGAGGACGAGCTGCGTACCGCCGACTACCTGCAACAGGGCCTTCGCGAGAACGGTTACGTGGT
CGACTGCGCCCACACAGGCACCGATGGCCTGCACCTGGCACGCCAACAGGCCTATGACCTGGTCATTCTCGACGTCAACC
TGCCCGAAATCGATGGCTGGACCGTGCTGCAGCGGCTACGTGCCGAATCGGCCACGCGGATCATGATGCTGACCGCCCAC
GGTCGCTTGGCCGACCGGGTAAAAGGCCTGGACTTGGGCGCGGATGACTACCTGCTCAAGCCCTTTGAGTTCCCTGAGCT
ACTGGCGCGCATCCGCAGCCTGCTACGCCGCAACGACCAGCAACTGCAGCCCAGCACCCTGCGCGTCGCTGACCTGGAAC
TGGACCCCGGCCGCCACCGCGCCTACCGCGCCGGGCAGCGCATCGACCTGACCGCCAAGGAGTTCGCCCTGCTGCACCTG
CTAATGCGCCAGACTGGCGAAGTGTTGTCGCGCACGCAAATCATCTCGCTGGTGTGGGACATGAACTTCGACTGCGACAC
CAACGTGGTCGAGGTCTCGATCCGGCGCCTGCGGGCGAAGATCGACGACCCGTTCGACAACAAGCTGATCCATACCCTGC
GTGGTGTGGGCTACGTACTTGAGGCTCGCCTTTGA

Protein sequence :
MRLLIIEDELRTADYLQQGLRENGYVVDCAHTGTDGLHLARQQAYDLVILDVNLPEIDGWTVLQRLRAESATRIMMLTAH
GRLADRVKGLDLGADDYLLKPFEFPELLARIRSLLRRNDQQLQPSTLRVADLELDPGRHRAYRAGQRIDLTAKEFALLHL
LMRQTGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDNKLIHTLRGVGYVLEARL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-55 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator BAC0125 Protein 6e-66 60
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-61 60
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator BAC0197 Protein 3e-64 59
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-55 59
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-57 55
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator BAC0111 Protein 8e-62 55
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator BAC0347 Protein 7e-58 51
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-38 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-32 42
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 1e-33 42
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 1e-28 42
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 4e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator VFG0596 Protein 6e-56 52
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator VFG1389 Protein 5e-36 44
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator VFG1386 Protein 4e-38 43
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator VFG1390 Protein 7e-38 42
Pput_4283 YP_001269591.1 two component heavy metal response transcriptional regulator VFG0473 Protein 9e-31 41