Gene Information

Name : RoseRS_2290 (RoseRS_2290)
Accession : YP_001276619.1
Strain : Roseiflexus sp. RS-1
Genome accession: NC_009523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2828111 - 2828785 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAGCACTATTTTAATCGTCGAAGATGAAGCCGAGATCGCGGGATATCTCCGGCGCGGGCTGACATTTGAGGGGTACAC
GGTCGAGATCGCAAGCGATGGACGCCAGGCGCTCGACATAGCCCGTGAACAGCCGCCTGATCTGGTGGTGCTCGATCTGA
TGCTGCCGGGCATCGATGGGCTGGAAGTTGCACGGCGGTTGCGCGCCGCGTCGGATGTGCCGATCATCATGCTGACGGCA
CGTGACGCCATTCCAGATCGGGTTGCCGGTCTCGAAGCCGGTGCAGATGACTACCTGATCAAACCGTTCGCTTTTGAAGA
ACTGCTGGCGCGCATTCGTGTCCAGCTCCGTCGCCGTCAGCGCGAAGACGCCGCAACCGTGCTGCGCTACGGTCCACTGA
CGATGGATCTGGCTGCGCACGAAGTTACCATTGGCGACCGCCGGGTCGATCTCACCGCCAAAGAGTACGATCTGCTCGAA
CTGTTCATGCGCCATCCGCAACAGGTCCTCACTCGCGATGTCATCTACGACCGCGTATGGGGCTACAACTTCGGCGGTGA
GAGCAACATCATCGAAGTGTACGTTCGCTATCTGCGCCAGAAACTCGAGGCGCACGGCGAACCGCGTCTGATCCATACCG
TGCGCGGCGTCGGGTATATTCTGCGCGAAGAATGA

Protein sequence :
MSTILIVEDEAEIAGYLRRGLTFEGYTVEIASDGRQALDIAREQPPDLVVLDLMLPGIDGLEVARRLRAASDVPIIMLTA
RDAIPDRVAGLEAGADDYLIKPFAFEELLARIRVQLRRRQREDAATVLRYGPLTMDLAAHEVTIGDRRVDLTAKEYDLLE
LFMRHPQQVLTRDVIYDRVWGYNFGGESNIIEVYVRYLRQKLEAHGEPRLIHTVRGVGYILREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-33 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-32 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_2290 YP_001276619.1 two component transcriptional regulator BAC0197 Protein 2e-34 49
RoseRS_2290 YP_001276619.1 two component transcriptional regulator BAC0638 Protein 2e-31 49
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator AE015929.1.gene1106. Protein 8e-32 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator BAC0083 Protein 7e-38 48
RoseRS_2290 YP_001276619.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-39 47
RoseRS_2290 YP_001276619.1 two component transcriptional regulator BAC0308 Protein 8e-35 47
RoseRS_2290 YP_001276619.1 two component transcriptional regulator BAC0111 Protein 3e-36 47
RoseRS_2290 YP_001276619.1 two component transcriptional regulator BAC0125 Protein 1e-37 46
RoseRS_2290 YP_001276619.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-33 46
RoseRS_2290 YP_001276619.1 two component transcriptional regulator BAC0347 Protein 2e-32 45
RoseRS_2290 YP_001276619.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-21 43
RoseRS_2290 YP_001276619.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_2290 YP_001276619.1 two component transcriptional regulator VFG1390 Protein 2e-49 57
RoseRS_2290 YP_001276619.1 two component transcriptional regulator VFG1386 Protein 5e-38 47
RoseRS_2290 YP_001276619.1 two component transcriptional regulator VFG0596 Protein 1e-33 46
RoseRS_2290 YP_001276619.1 two component transcriptional regulator VFG1389 Protein 4e-38 46
RoseRS_2290 YP_001276619.1 two component transcriptional regulator VFG1563 Protein 7e-25 41