Gene Information

Name : RoseRS_2625 (RoseRS_2625)
Accession : YP_001276951.1
Strain : Roseiflexus sp. RS-1
Genome accession: NC_009523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3255490 - 3256185 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCGCCTGTTATTGATTGAAGATGAGGATGACCTGGCGCACGCACTGGTACGCGGACTCCGCCAACAGGGGTATGCTGT
GGATTGGGCAGCTGATGGAGAACAGGGATGTGAACTTGCAAGCATCAATGAATATGATCTCATCATTCTGGATCTCAACC
TACCTGCACTTGACGGACTCGATGTTTGCCGATACCTTCGAGCAAATTATCCACACCTCTTAATCTTAATATTGACGGCT
CGGGATCAACCAGAGGAGCGTGTCATTGGTCTTGATACCGGTGCCGATGACTATCTGATCAAGCCGTTTCATTTCGGTGA
ATTACTGGCGCGTATCCGGGCGCTTCTCCGGCGCGATTTACGAGTTCGCCAACCGCTGCTCCAGTATCGAGATCTGAAAC
TTGATCCTGCTACTCAAACCGTCTGGCTCAACAACCAACGCTTGAATCTTACCCGCAAGGAGTTTGCGATCCTCTCCTAT
CTTATGCGTCATCAGGGCGAGGTTATCACCCAAGAAATGCTGTTAGAACATGTATGGGACGGAACTGTAAATCCCTTCAC
CAACACCGTGAGGGTTCATATTAATGCCCTCAGGCGCAAGTTGAGGGACACTATAGCGCCGTACCGCTATATAGAGACTG
TGGTTGGCGTGGGGTATCGGCTTGGGAACGCAGGTGAATCGGAGCAAGAAGTATGA

Protein sequence :
MRLLLIEDEDDLAHALVRGLRQQGYAVDWAADGEQGCELASINEYDLIILDLNLPALDGLDVCRYLRANYPHLLILILTA
RDQPEERVIGLDTGADDYLIKPFHFGELLARIRALLRRDLRVRQPLLQYRDLKLDPATQTVWLNNQRLNLTRKEFAILSY
LMRHQGEVITQEMLLEHVWDGTVNPFTNTVRVHINALRRKLRDTIAPYRYIETVVGVGYRLGNAGESEQEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_2625 YP_001276951.1 two component transcriptional regulator BAC0083 Protein 5e-30 43
RoseRS_2625 YP_001276951.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-34 42
RoseRS_2625 YP_001276951.1 two component transcriptional regulator BAC0197 Protein 9e-28 42
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-27 42
RoseRS_2625 YP_001276951.1 two component transcriptional regulator BAC0487 Protein 3e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-24 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-22 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 4e-32 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator BAC0288 Protein 5e-30 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator BAC0125 Protein 6e-28 41
RoseRS_2625 YP_001276951.1 two component transcriptional regulator BAC0111 Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_2625 YP_001276951.1 two component transcriptional regulator VFG0596 Protein 9e-28 43
RoseRS_2625 YP_001276951.1 two component transcriptional regulator VFG0473 Protein 2e-24 41