Gene Information

Name : RoseRS_3485 (RoseRS_3485)
Accession : YP_001277793.1
Strain : Roseiflexus sp. RS-1
Genome accession: NC_009523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4369090 - 4369800 bp
Length : 711 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAGCACCATTCTGGTTGTTGATGATGAGCCGGCGCTCCGCGATATGCTCCGGCTCTATCTCGAACAGGAAGGGTTTCA
CGTCGTTGAAGCCGGCGACGGACGACGCGCATTATACGTCGCGCGCGTCGAAAAACCCGATCTGGTCGTCCTCGACCTGA
TGATGCCGGAGATGGGCGGGTACGAGTTCCTCCGCGCCTTCGCAAAGGAGTCGCGCACGCCGGTCATCGTGCTGACCGCG
AAGATCGAAGATACGGATAAGATCCTGGGGCTGGAACTCGGCGCGGATGATTATGTCACCAAACCGTTCAATGTGCGTGA
ACTGATCGCCCGCATCCGCGCGGTGCTGCGCCGCACCCAACAGACGCCCCTGGAACCGGATGTGCTGCGCGCCGCTGATA
TTGTCCTTGATCGCACTGGTCGCACTGTGCGCGTCGGTGGGCGTTATGTCGATCTGACACCGTCGGAGTTCGCTATTCTG
GCGACGCTCATGGCTGCGCCGGGGCAGGTGTTCTCCCGTCTGGATCTGCTCGACCGCGTTTCCGGCGATGCATTCGAAGG
CTCAGAACGCACCATCGATGTCCATATTCGCAATCTGCGCGCCAAGATCGAGGCAGATCCGCGCCATCCCCAATATATTG
AAACGGTGTACGGCATGGGGTATCGTTTTGCGTTGCCGCGCACATCGAACCCCGCAGCGACAGGCGTTTGA

Protein sequence :
MSTILVVDDEPALRDMLRLYLEQEGFHVVEAGDGRRALYVARVEKPDLVVLDLMMPEMGGYEFLRAFAKESRTPVIVLTA
KIEDTDKILGLELGADDYVTKPFNVRELIARIRAVLRRTQQTPLEPDVLRAADIVLDRTGRTVRVGGRYVDLTPSEFAIL
ATLMAAPGQVFSRLDLLDRVSGDAFEGSERTIDVHIRNLRAKIEADPRHPQYIETVYGMGYRFALPRTSNPAATGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_3485 YP_001277793.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-40 46
RoseRS_3485 YP_001277793.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-34 45
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP000675.2.gene1535. Protein 7e-41 44
RoseRS_3485 YP_001277793.1 two component transcriptional regulator AE016830.1.gene1681. Protein 6e-39 43
RoseRS_3485 YP_001277793.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-37 43
RoseRS_3485 YP_001277793.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-39 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 9e-39 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-39 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator BAC0197 Protein 2e-30 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-36 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-30 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP001485.1.gene721.p Protein 3e-32 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator BAC0125 Protein 8e-29 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP000034.1.gene3671. Protein 3e-34 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-35 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-25 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP001138.1.gene4273. Protein 1e-27 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator NC_002695.1.915041.p Protein 1e-28 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-29 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator BAC0533 Protein 2e-27 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-36 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP000034.1.gene3834. Protein 1e-28 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP000647.1.gene4257. Protein 2e-27 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator NC_012469.1.7686381. Protein 8e-35 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP001138.1.gene2239. Protein 4e-35 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator BAC0596 Protein 4e-35 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-35 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-35 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-36 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator BAC0039 Protein 4e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_3485 YP_001277793.1 two component transcriptional regulator VFG1390 Protein 1e-28 43
RoseRS_3485 YP_001277793.1 two component transcriptional regulator VFG1702 Protein 5e-39 42
RoseRS_3485 YP_001277793.1 two component transcriptional regulator VFG1563 Protein 6e-39 41
RoseRS_3485 YP_001277793.1 two component transcriptional regulator VFG1389 Protein 8e-22 41