Gene Information

Name : RoseRS_0761 (RoseRS_0761)
Accession : YP_001275127.1
Strain : Roseiflexus sp. RS-1
Genome accession: NC_009523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 940843 - 941532 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCAGGGGAATGATCAGCGTCGGATCCTGATTGTGGACGACGAACCCGGGCTGCGCGATCTGGTGCGCATCAATCTTGA
GCACGAAGGATTCAGCGTGCTGGAAGCCGAAAGCGGCGCCCAGGGTCTGCAAATGGTGCGGGAACAGCATCCCGATCTGA
TGATCCTCGATGTGATGATGCCGGAAATGGACGGATGGGAGGTCTGCCGTCGTCTGCGCGAATTCTCACAGATACCGGTG
CTGATGTTGACTGCGCGCACCCAGAGCAAAGATATCGTCACCGGTCTGGAAAGCGGCGCCGACGATTACCTGACCAAGCC
GTTCAATATGGACGAGTTGACGGCACGCATTCGCGCATTGCTACGGCGGGTGCCCTCGCCCAATCGCCCGATCGTTGCAG
GCGGCGGTGAAATTGTGATCGATAAGCAGAAGCGCGAGGTTCTGGTGCGTGGCGAGCCGGTCGATCTGACGCCGACCGAG
TACGATCTGCTTCTCCTGCTCGCCGAGCACGCCGGCGCCGTGCTCGACCACGAGACCCTGCTGCGCGGCGTGTGGGGGCA
CGAATACACCAGAGATAACGATTACCTCAAGGTGTATATCTGGCACCTGCGCCGAAAAATCGAACAGGATCCGCGTGAGC
CGAAACTGCTGCTGACTGAATGGGGCGTCGGGTATCGTCTGGCGCCGTAG

Protein sequence :
MQGNDQRRILIVDDEPGLRDLVRINLEHEGFSVLEAESGAQGLQMVREQHPDLMILDVMMPEMDGWEVCRRLREFSQIPV
LMLTARTQSKDIVTGLESGADDYLTKPFNMDELTARIRALLRRVPSPNRPIVAGGGEIVIDKQKREVLVRGEPVDLTPTE
YDLLLLLAEHAGAVLDHETLLRGVWGHEYTRDNDYLKVYIWHLRRKIEQDPREPKLLLTEWGVGYRLAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-32 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-35 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-36 44
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-38 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-40 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-33 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator BAC0125 Protein 3e-31 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-38 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-39 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator BAC0083 Protein 1e-32 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-39 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator BAC0197 Protein 4e-29 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator CP004022.1.gene3215. Protein 5e-26 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002695.1.915041.p Protein 1e-21 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator CP000034.1.gene3834. Protein 1e-21 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator CP000675.2.gene1535. Protein 2e-31 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator BAC0308 Protein 1e-31 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-31 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-37 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator BAC0638 Protein 2e-29 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-36 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator CP000647.1.gene4257. Protein 5e-22 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator CP001138.1.gene4273. Protein 8e-22 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator BAC0533 Protein 5e-22 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_0761 YP_001275127.1 two component transcriptional regulator VFG1390 Protein 8e-39 44
RoseRS_0761 YP_001275127.1 two component transcriptional regulator VFG1389 Protein 8e-32 44
RoseRS_0761 YP_001275127.1 two component transcriptional regulator VFG1386 Protein 2e-37 43
RoseRS_0761 YP_001275127.1 two component transcriptional regulator VFG0596 Protein 3e-32 42
RoseRS_0761 YP_001275127.1 two component transcriptional regulator VFG1563 Protein 2e-35 41
RoseRS_0761 YP_001275127.1 two component transcriptional regulator VFG1702 Protein 5e-36 41