Gene Information

Name : PsycPRwf_0235 (PsycPRwf_0235)
Accession : YP_001279143.1
Strain : Psychrobacter sp. PRwf-1
Genome accession: NC_009524
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 276694 - 277005 bp
Length : 312 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein

DNA sequence :
ATGACCACCAAACGCGGATGCTACAGCACTGAGTTCAAGTTAGAAGCCATTCAACTGGTTGAAGAACAAGGCAGAAAGAT
ACCAGAAGTTGCCAGTTCATTAGGCATTGGCAAAACCACGCTTGAGAATTGGGTATACAAATATAGAAAAGAACAGCAAG
GTATCATGCCGTCAGAAGGCAAAGCGCTAACACCTGAATTGCGACGTATCCAAGAGCTTGAAAAGCAAGTCAAACAGCTC
AAGATGGAGCGAGATATACTAAAAAAGGCATCTGCTCTGCTAGCCCAAGACAATCTGAACGTCTATCGCTAG

Protein sequence :
MTTKRGCYSTEFKLEAIQLVEEQGRKIPEVASSLGIGKTTLENWVYKYRKEQQGIMPSEGKALTPELRRIQELEKQVKQL
KMERDILKKASALLAQDNLNVYR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-15 47
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-15 47
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-15 47
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-15 47
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-16 47
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-16 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 46
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 46
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-14 46
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 46
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 46
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-14 46
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 46
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-14 46
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-14 46
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-13 45
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 3e-12 45
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-14 44
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-13 43
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-13 42
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-13 42
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-12 41
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 2e-13 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PsycPRwf_0235 YP_001279143.1 transposase IS3/IS911 family protein VFG0784 Protein 2e-15 47
PsycPRwf_0235 YP_001279143.1 transposase IS3/IS911 family protein VFG1566 Protein 6e-13 46
PsycPRwf_0235 YP_001279143.1 transposase IS3/IS911 family protein VFG1123 Protein 3e-14 46
PsycPRwf_0235 YP_001279143.1 transposase IS3/IS911 family protein VFG1521 Protein 1e-12 45
PsycPRwf_0235 YP_001279143.1 transposase IS3/IS911 family protein VFG1485 Protein 2e-13 42
PsycPRwf_0235 YP_001279143.1 transposase IS3/IS911 family protein VFG1553 Protein 1e-12 41