Gene Information

Name : BDI_1054 (BDI_1054)
Accession : YP_001302442.1
Strain : Parabacteroides distasonis ATCC 8503
Genome accession: NC_009615
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1222675 - 1223352 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGGCGAAGATATTATTAGTAGAAGACGAGGTAAACATCGCCTCTTTTATAGAAAGAGGCTTGCGGGAGTTCGGGCATGA
GGTATATGTCGCTTATGACGGTGCCGCTGGTTGGGAACTGACACAGAAGAACGATTTCCAATTGCTGATTCTGGATATTA
TAATGCCGAAGATGAACGGCCTGCAACTTTGCAAACAGTACCGGCAACGGTTCGGTTACCATGCTCCCGTGATCATGCTG
ACCGCCTTGGGAACCACCGAGGATATCGTTAGTGGGCTGGATGCCGGGGCGGATGATTATCTGGTAAAACCTTTCAGCTT
CCAAGAGCTCGAGGCCCGCATAAAGGCGTTATTACGTCGATCGGGAAACGAATCCGTCCATATGGCTCTTCGGTGCGGGG
ATCTGGTCTTAGATCCTCCAAGCCATCGGGCTATACGGAATGGGCAGGTCATCGATTTGACGGTAAAGGAATATAGGCTC
TTGGAATATTTCATACAGAACCAAGGAACGGCCCTGAGCCGGATGAACTTGCTAAAGAATGTCTGGGACAAGGATTTCGA
TACCAATACGAACGTGGTTGATGTCTACGTGAATTATTTGCGCACGAAGATAGACAAGGACTTCGAACCTAAGCTAATCC
ATACCGTGGTGGGCGTGGGCTATATGATGGAAGCATGA

Protein sequence :
MAKILLVEDEVNIASFIERGLREFGHEVYVAYDGAAGWELTQKNDFQLLILDIIMPKMNGLQLCKQYRQRFGYHAPVIML
TALGTTEDIVSGLDAGADDYLVKPFSFQELEARIKALLRRSGNESVHMALRCGDLVLDPPSHRAIRNGQVIDLTVKEYRL
LEYFIQNQGTALSRMNLLKNVWDKDFDTNTNVVDVYVNYLRTKIDKDFEPKLIHTVVGVGYMMEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BDI_1054 YP_001302442.1 two-component system response regulator BAC0111 Protein 1e-42 47
BDI_1054 YP_001302442.1 two-component system response regulator BAC0347 Protein 1e-38 46
BDI_1054 YP_001302442.1 two-component system response regulator BAC0308 Protein 3e-36 44
BDI_1054 YP_001302442.1 two-component system response regulator BAC0083 Protein 1e-38 44
BDI_1054 YP_001302442.1 two-component system response regulator HE999704.1.gene1528. Protein 8e-28 43
BDI_1054 YP_001302442.1 two-component system response regulator BAC0638 Protein 2e-31 43
BDI_1054 YP_001302442.1 two-component system response regulator AE015929.1.gene1106. Protein 4e-25 42
BDI_1054 YP_001302442.1 two-component system response regulator BAC0125 Protein 5e-36 42
BDI_1054 YP_001302442.1 two-component system response regulator BAC0197 Protein 9e-35 42
BDI_1054 YP_001302442.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-28 41
BDI_1054 YP_001302442.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-28 41
BDI_1054 YP_001302442.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-28 41
BDI_1054 YP_001302442.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-28 41
BDI_1054 YP_001302442.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-28 41
BDI_1054 YP_001302442.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-28 41
BDI_1054 YP_001302442.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-28 41
BDI_1054 YP_001302442.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BDI_1054 YP_001302442.1 two-component system response regulator VFG1390 Protein 4e-35 44
BDI_1054 YP_001302442.1 two-component system response regulator VFG1389 Protein 3e-29 44
BDI_1054 YP_001302442.1 two-component system response regulator VFG0596 Protein 3e-31 42
BDI_1054 YP_001302442.1 two-component system response regulator VFG0473 Protein 4e-24 41