Gene Information

Name : Tmel_1838 (Tmel_1838)
Accession : YP_001307058.1
Strain : Thermosipho melanesiensis BI429
Genome accession: NC_009616
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1822288 - 1823007 bp
Length : 720 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGGTAAAAGGAAAATCATGGTTATTGATGATCAACCGGAAATTCTTGAATTAATAAGTTTTACCTTAGAGAAAGAGGG
GTATGATGTCATTCCCGTTGAAGATGCTGAAAAAGCTCTTGAAGAATTAAAAGACAAAGATGTTGATATGTTTTTAGTAG
ATATTATGTTACCAGGAATAGACGGATTTGAATTTGTAAGACACATTAGAAGCTTAGAACAACATAAATTAACACCTGTA
ATCTTTTTAAGTGCAAAAGGTGAAGAATTTGATAAAGTATTAGGCTTAGAATTAGGAGCAGATGATTATATTACAAAACC
ATTCAGTATTAGGGAATTACTCGCTAGAATTAAAGCAGTCTTTAGAAGAATGCAACTATCAACACAAACAAAAGAAGAAA
AACCAAAAAAAATAGTAGCAAAAGACCTTGAAATTGATGTTGACAAATACGAAGTGAAAATAAAAGGTAAAAAAGTAAAT
TTAACTCCTTTGGAATTTGATCTTTTAAGATTTTTAGCAGAAAACGAAGGTAAAGTTTTTTCAAGGAATGTTCTTTTAGA
TAAACTATGGGGATACGATTATTTTGGAGATACTAGAACTGTTGATGTTCATATTAGAAGATTAAGGACAAAAATAGAAG
AAGACCCCTCAAATCCAAAATACATTGTAACAGTAAGGGGAAAAGGATACAAATTTAGAGATCCTGGAAAGGAAGAATAA

Protein sequence :
MGKRKIMVIDDQPEILELISFTLEKEGYDVIPVEDAEKALEELKDKDVDMFLVDIMLPGIDGFEFVRHIRSLEQHKLTPV
IFLSAKGEEFDKVLGLELGADDYITKPFSIRELLARIKAVFRRMQLSTQTKEEKPKKIVAKDLEIDVDKYEVKIKGKKVN
LTPLEFDLLRFLAENEGKVFSRNVLLDKLWGYDYFGDTRTVDVHIRRLRTKIEEDPSNPKYIVTVRGKGYKFRDPGKEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-43 46
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-43 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-51 50
Tmel_1838 YP_001307058.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-48 49
Tmel_1838 YP_001307058.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-51 46
Tmel_1838 YP_001307058.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 5e-44 45
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-47 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-41 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-41 44
Tmel_1838 YP_001307058.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-42 43
Tmel_1838 YP_001307058.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-43 43
Tmel_1838 YP_001307058.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-30 42
Tmel_1838 YP_001307058.1 two component transcriptional regulator AM180355.1.gene1830. Protein 8e-38 42
Tmel_1838 YP_001307058.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-41 42
Tmel_1838 YP_001307058.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 9e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmel_1838 YP_001307058.1 two component transcriptional regulator VFG1702 Protein 1e-43 46
Tmel_1838 YP_001307058.1 two component transcriptional regulator VFG1563 Protein 3e-43 45