Gene Information

Name : Cbei_2249 (Cbei_2249)
Accession : YP_001309368.1
Strain : Clostridium beijerinckii NCIMB 8052
Genome accession: NC_009617
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2612293 - 2612976 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ctc:CTC00805 two-component response regulator

DNA sequence :
ATGAAAACAAATATTTTAGTTGTAGATGATGATAAGAGTATTCGTAATTTAATCAAAGTTTATCTTGAGAATGAAGGTTA
TAATATTATGGAAGCTTCAAATGGAGCGGAAGCTTTGATTTTGATTAATGAAAATAATTTTGATTTAATTATTTTAGATG
TTATGATGCCAGTTTTAGATGGCATAAGCGCTTGCCTTAAAATTAGAGAAGATTACACTATGCCTATAATATTTTTATCG
GCAAAAGATGAAGAAATTCATAAAATTGAAGGTTTAACAGTTGGCGCTGATGATTATATTACTAAACCTTTTGGTTCTAT
GGAGCTTATAGCTAGAGTAAAGGCTCAACTTAGAAGATATAAAAAATTTAATGTAGAACCTCAAAATAGTAGTAGTATTA
CTATTGAAGAATTAACTATTAATTTTGATACTCATGAAGTTACAGTGAGAGGTGATAAAATTAAGCTTACTCCAAAGGAG
TTTGATATATTGGAGTGTTTAGCTAAAAATAGAGGTGTAGTATTTTCTGTACAAAAATTGTATGAGACTATTTGGAATGA
ACAATTTGCAGTATCAGATACTTCTATAGTGGTTCATATAACAAACCTTAGACAAAAAATTGAAATAGATCCTAAAAGCC
CAAAATATATTAAAACAGTTTGGGGAGTTGGATATAAGATATGA

Protein sequence :
MKTNILVVDDDKSIRNLIKVYLENEGYNIMEASNGAEALILINENNFDLIILDVMMPVLDGISACLKIREDYTMPIIFLS
AKDEEIHKIEGLTVGADDYITKPFGSMELIARVKAQLRRYKKFNVEPQNSSSITIEELTINFDTHEVTVRGDKIKLTPKE
FDILECLAKNRGVVFSVQKLYETIWNEQFAVSDTSIVVHITNLRQKIEIDPKSPKYIKTVWGVGYKI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-52 51
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-52 51
Cbei_2249 YP_001309368.1 two component transcriptional regulator AM180355.1.gene1830. Protein 5e-51 49
Cbei_2249 YP_001309368.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-49 48
Cbei_2249 YP_001309368.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 8e-48 46
Cbei_2249 YP_001309368.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-49 46
Cbei_2249 YP_001309368.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-41 46
Cbei_2249 YP_001309368.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 6e-48 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-40 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-50 45
Cbei_2249 YP_001309368.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-40 44
Cbei_2249 YP_001309368.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-37 43
Cbei_2249 YP_001309368.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-46 42