Gene Information

Name : Cbei_3565 (Cbei_3565)
Accession : YP_001310643.1
Strain : Clostridium beijerinckii NCIMB 8052
Genome accession: NC_009617
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4115538 - 4116218 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cpf:CPF_1056 DNA-binding response regulator

DNA sequence :
ATGGTTAAAATTTTAATTGTTGAGGATGATGAGAAACTTGCAAGATTTGTAGAGTTAGAATTATTACATGAAGGATATGA
AATCTTAAAAGCGGATAATGGAAGATTAGGTCTTGAAATAGCTGAGAAGGGTGAAGTAGATTTAGTACTTCTTGATATAA
TGATTCCACAAATAAATGGATTAGAAGTATTACGTAGAATTAGGAAAACTTCAGATTTGCCTGTTATAATGCTTACTGCA
AGGGATGCTGTTATGGATAAAGTATCTGGACTTGATGCAGGAGCAGATGATTATATAACAAAACCTTTTGCAATAGAAGA
GTTATTAGCAAGAATAAGAACAGCGCTTAAAAGAAGAACTGTTATTGAAAAAAGAGATACAGACATAATAAGCTGCGGAT
TATTGTCTTTAGATAAGATGAGACATAAGGTAACGTATGATAATAAAGAAATAGAATTAACAAACAGAGAGTTTACTTTA
CTAAAAATTTTATTGGAAAATAAGAACATAGTATTAACAAGAGATATACTAATGGAAAAAGTATGTGGCTATGATTATAT
TGGAGAAACTAATGTAATAGATGTTTATATAAGATTTTTAAGAACTAAAATAGATGATGCATTTAAAACAAAGATAATAA
CCACAGTACGTGGAGTAGGATACGTTATTAAAGATGAATAA

Protein sequence :
MVKILIVEDDEKLARFVELELLHEGYEILKADNGRLGLEIAEKGEVDLVLLDIMIPQINGLEVLRRIRKTSDLPVIMLTA
RDAVMDKVSGLDAGADDYITKPFAIEELLARIRTALKRRTVIEKRDTDIISCGLLSLDKMRHKVTYDNKEIELTNREFTL
LKILLENKNIVLTRDILMEKVCGYDYIGETNVIDVYIRFLRTKIDDAFKTKIITTVRGVGYVIKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cbei_3565 YP_001310643.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-46 54
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-46 52
Cbei_3565 YP_001310643.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-43 50
Cbei_3565 YP_001310643.1 two component transcriptional regulator BAC0308 Protein 3e-41 44
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-38 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator BAC0125 Protein 1e-38 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator BAC0347 Protein 9e-34 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-36 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_012469.1.7686381. Protein 6e-34 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-36 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator BAC0197 Protein 4e-39 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator BAC0111 Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cbei_3565 YP_001310643.1 two component transcriptional regulator VFG0596 Protein 1e-37 42
Cbei_3565 YP_001310643.1 two component transcriptional regulator VFG1390 Protein 4e-39 41