Gene Information

Name : SaurJH1_2803 (SaurJH1_2803)
Accession : YP_001312298.1
Strain :
Genome accession: NC_009619
Putative virulence/resistance : Unknown
Product : integrase catalytic region
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3316
EC number : -
Position : 7086 - 7760 bp
Length : 675 bp
Strand : +
Note : PFAM: Integrase catalytic region; KEGG: sha:SH0760 transposase for IS431mec

DNA sequence :
ATGAACTATTTCAGATATAAACAATTTAACAAAGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATGCATTGAG
TTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACAGTCTACCGTTGGGTTCAAGAAT
ATGCCCCAATTTTGTATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATC
AAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCA
ACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATC
AGGCACCTTCAACGAAAGTAGCAATAGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAA
TATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGATATCAAAGTATCAATACGGCAAA
AAATACACTCAAAGGCATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGATCTCTTCAGATCTACGGATTTTCGC
CATGCCACGAAATTAGGGATATGTTAGCCAGTTAA

Protein sequence :
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYI
KIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAIAKVIKAFKLKPDCHCTSK
YLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEIRDMLAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAB47648.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 6e-90 99
SAUSA300_0028 YP_492748.1 putative transposase Not tested Type-IV SCCmec Protein 4e-90 99
SAR0027 YP_039504.1 transposase Not tested Type-II SCCmec Protein 4e-90 99
SERP2526 YP_190067.1 IS431mec-like transposase Not tested Type-II SCCmec Protein 4e-90 99
SAR0034 YP_039511.1 transposase Not tested Type-II SCCmec Protein 4e-90 99
tnp BAA86652.1 transposase Not tested Type-I SCCmec Protein 3e-90 99
tnp YP_252002.1 transposase for IS431mec Not tested SCCmec Protein 4e-90 99
SAMSHR1132_00280 YP_005324552.1 putative transposase Not tested Type-IIIinv SCCmec Protein 4e-90 99
unnamed BAB47631.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 3e-90 99
MW0027 NP_644842.1 transposase for IS-like element Not tested Type-IV SCCmec Protein 4e-90 99
SAPIG0054 YP_005732864.1 transposase Not tested Type-V SCCmec Protein 9e-90 99
tnp BAB72117.1 transposase of IS431mec Not tested Type-IVa SCCmec Protein 3e-90 99
tnp NP_370551.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-90 99
SE0090 NP_763645.1 transposase for IS-like element Not tested SCCpbp4 Protein 9e-90 99
tnp BAB72136.1 transposase of IS431mec Not tested Type-IVb SCCmec Protein 3e-90 99
tnp NP_370560.2 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-90 99
SE0079 NP_763634.1 transposase for IS-like element Not tested SCCpbp4 Protein 8e-90 99
tnp BAC67570.1 transposase of IS431mec Not tested Type-IVc SCCmec Protein 3e-90 99
SA0026 NP_373265.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-90 99
unnamed BAA82228.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-90 99
unnamed BAB47638.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 6e-90 99
SA0034 NP_373274.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-90 99
SACOL0028 YP_184939.1 IS431mec, transposase Not tested Type-I SCCmec Protein 4e-90 99
unnamed BAA82238.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-90 99
SAPIG0038 YP_005732848.1 transposase Not tested Type-V SCCmec Protein 2e-89 98
SE0071 NP_763626.1 transposase for IS-like element Not tested SCCpbp4 Protein 2e-89 98
SERP1579 YP_189144.1 IS431mec-like transposase Not tested ¥ÕSP¥â Protein 9e-90 98
unnamed ACL99852.1 transposase Not tested Type-V SCCmec Protein 2e-89 98
tnp BAG06195.1 transposase for IS431 Not tested Type-VII SCCmec Protein 2e-89 98
unnamed BAB47635.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 1e-89 98
tnp BAD24823.1 transposase for IS431 Not tested Type-V SCCmec Protein 1e-89 98
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 5e-90 98
tnp YP_252034.1 transposase for IS431mec Not tested SCCmec Protein 4e-89 98
unnamed BAD24828.1 transposase for IS431 Not tested Type-V SCCmec Protein 3e-89 97
unnamed AAP55235.1 transposase Not tested SaPIbov2 Protein 2e-88 96
tnp YP_254240.1 transposase for IS431mec Not tested ¥ðSh1 Protein 2e-87 96
tnp YP_251940.1 transposase for IS431mec Not tested SCCmec Protein 4e-88 96
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 4e-55 61
ef0039 AAM75245.1 EF0039 Not tested Not named Protein 8e-47 55
tnpA6100 ACN62081.1 TnpA6100 Not tested SGI1 Protein 3e-26 43
tnpA6100 ACN81001.1 transposase Not tested AbaR5 Protein 4e-26 43
tnpA6100 AGK06983.1 IS6100 transposase Not tested SGI1 Protein 2e-26 43
tnpA6100 AGK07042.1 IS6100 transposase Not tested SGI1 Protein 2e-26 43
tnpA6100 AGK07113.1 IS6100 transposase Not tested SGI1 Protein 2e-26 43
tnpA AAG03007.1 transposase Not tested SGI1 Protein 2e-26 43
tnp6100 ACS32049.1 Tnp6100 Not tested SGI2 Protein 2e-26 43
tnp6100 ACX47960.1 tnp6100 Not tested SGI1 Protein 6e-27 43
tnpA6100 AGF34993.1 IS6100 transposase Not tested SGI1 Protein 2e-26 43
CDBH8_0916 YP_005160008.1 transposase-like protein Not tested Not named Protein 4e-26 43
tnpA6100 AGK07018.1 IS6100 transposase Not tested SGI1 Protein 6e-27 43
tnpA6100 AGF35032.1 IS6100 transposase Not tested SGI1 Protein 2e-26 43
tnpA6100 AGK07076.1 IS6100 transposase Not tested SGI1 Protein 6e-27 43
tnpA6100 AGF35067.1 IS6100 transposase Not tested SGI1 Protein 2e-26 43
tnpA6100 AGK06937.1 IS6100 transposase Not tested SGI1 Protein 2e-26 43
tnpA CAJ77056.1 Transposase Not tested AbaR1 Protein 2e-26 43
tpnIS26 ADZ05778.1 transposase Not tested AbaR12 Protein 2e-24 41
tpnIS26 ADZ05794.1 transposase Not tested AbaR16 Protein 2e-24 41
tnpA26 AGK07039.1 IS26 transposase Not tested SGI1 Protein 1e-24 41
tnpA26 ACK44541.1 TnpA Not tested SGI1 Protein 1e-24 41
tpnIS26 ADZ05796.1 transposase Not tested AbaR17 Protein 2e-24 41
tnpA26 ACN81013.1 transposase of IS26 Not tested AbaR5 Protein 2e-24 41
tnpA26 AGK07092.1 IS26 transposase Not tested SGI1 Protein 1e-24 41
tnpA26 ACK44543.1 TnpA Not tested SGI1 Protein 1e-24 41
tpnIS26 ADZ05798.1 transposase Not tested AbaR18 Protein 2e-24 41
tnpA26 AGK07095.1 IS26 transposase Not tested SGI1 Protein 1e-24 41
tpnIS26 ADZ05788.1 transposase Not tested AbaR15 Protein 1e-24 41
tpnIS26 ADZ05810.1 transposase Not tested AbaR20 Protein 2e-24 41
tnpA26 AGK07097.1 IS26 transposase Not tested SGI1 Protein 1e-24 41
tpnIS26 ADZ05800.1 transposase Not tested AbaR19 Protein 1e-24 41
tnpA26 AFV53109.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-24 41
tnpA26 AFV53107.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-24 41
tnpA AET25383.1 TnpA Not tested PAGI-2(C) Protein 1e-24 41
tnp26 AGK36641.1 transposase of IS26 Not tested AbaR26 Protein 2e-24 41
Pmu_03480 YP_005176246.1 IS26 transposase Not tested ICEPmu1 Protein 3e-24 41
tnpA26 AFV53108.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-24 41
tnpA AFG30106.1 TnpA Not tested PAGI-2 Protein 1e-24 41
tnpA26 ACV89829.1 transposase of IS26 Not tested AbaR6 Protein 2e-24 41
tnpA26 ACN81016.1 transposase of IS26 Not tested AbaR5 Protein 3e-24 41
tnpA26 AFV53110.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-24 41
tnpA26 AGK07034.1 IS26 transposase Not tested SGI1 Protein 1e-24 41
tnp26 AGK36639.1 transposase of IS26 Not tested AbaR26 Protein 2e-24 41
tnpA26 ACV89831.1 transposase of IS26 Not tested AbaR7 Protein 2e-24 41
Pmu_03450 YP_005176243.1 IS26 transposase Not tested ICEPmu1 Protein 2e-24 41
tnpA26 AFV53122.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-24 41
tnpA26 AGK07037.1 IS26 transposase Not tested SGI1 Protein 1e-24 41
tnpA26 ADK35781.1 transposase of IS26 Not tested AbaR8 Protein 2e-24 41
tnpA26 ACN81018.1 transposase of IS26 Not tested AbaR5 Protein 2e-24 41
unnamed AEZ06025.1 TnpA26, Transposase of IS26 Not tested AbaR24 Protein 1e-24 41
ABTW07_3872 YP_005797120.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 3e-24 41
tnp7109-28 YP_001800928.1 transposase for insertion sequence Not tested Not named Protein 2e-24 41
ABTW07_3875 YP_005797123.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 3e-24 41
tnp7109-29 YP_001800930.1 transposase for insertion sequence Not tested Not named Protein 2e-24 41
ABTW07_3890 YP_005797138.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 3e-24 41
IS26 CAJ77078.1 Insertion sequence Not tested AbaR1 Protein 2e-24 41
ABTW07_3906 YP_005797154.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 3e-24 41
IS26 CAJ77074.1 Insertion sequence Not tested AbaR1 Protein 1e-24 41