Gene Information

Name : Amet_2866 (Amet_2866)
Accession : YP_001320675.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2880050 - 2880739 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cpf:CPF_0623 DNA-binding response regulator

DNA sequence :
ATGAACGGGAAGAATATATTGGTTGTAGATGATGAGGAGCATATTATTGAATTAATTAAGTTTAACTTGGAGAAAAATGG
TTTTTCAGTATTGACAAGTGATAATGGAGAAGAAAGTATTGAGTTGGTGAAAAACAATGATGTGGACTTAATTGTGTTAG
ACTTAATGTTACCAGGAATAGATGGGATAGAGGTTTGCAAGCGAATTAGAAGAATGGACGATTATGACAAAACACCAATT
ATCATGCTAACGGCTATGGGTGAAGAAACTGACCGCATTTTAGGGTTAGAGCTAGGCGCTGATGATTATATGACGAAGCC
CTTTAGCATACGAGAATTGGTTGCTCGCATCAAGGCAGTTTTAAGAAGAAGTGAAGAAAAACAAACAGTGAGAGCAATTA
AACTGGTAGTCAAGGATTTGATGATTGACACTGAAAAGCATGAGGTTCGAATAAAGGATCAACCAATTGAGCTCACATTA
AAAGAATTTGAGCTGGTTAGAATTTTAGCAGAAAACAGAGGTAAGGTACTATCAAGAAACCTGTTATTAGATGAAGTATG
GGGATATGATTACTTTGGGGAAACCCGTACTGTAGATGTACATATTCGCCACCTTAGGAAGAAAATAGGTGACGACCAAA
GTGGTGAATATATTGAAACCATTAGGGGCGTCGGATATAAGATGAAGTAG

Protein sequence :
MNGKNILVVDDEEHIIELIKFNLEKNGFSVLTSDNGEESIELVKNNDVDLIVLDLMLPGIDGIEVCKRIRRMDDYDKTPI
IMLTAMGEETDRILGLELGADDYMTKPFSIRELVARIKAVLRRSEEKQTVRAIKLVVKDLMIDTEKHEVRIKDQPIELTL
KEFELVRILAENRGKVLSRNLLLDEVWGYDYFGETRTVDVHIRHLRKKIGDDQSGEYIETIRGVGYKMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-40 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_2866 YP_001320675.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-54 56
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_012469.1.7685629. Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-49 49
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-49 48
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-47 47
Amet_2866 YP_001320675.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-49 47
Amet_2866 YP_001320675.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-36 44
Amet_2866 YP_001320675.1 two component transcriptional regulator CP000647.1.gene4257. Protein 5e-32 43
Amet_2866 YP_001320675.1 two component transcriptional regulator CP001138.1.gene4273. Protein 9e-32 43
Amet_2866 YP_001320675.1 two component transcriptional regulator BAC0533 Protein 5e-32 43
Amet_2866 YP_001320675.1 two component transcriptional regulator BAC0125 Protein 5e-36 43
Amet_2866 YP_001320675.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-37 42
Amet_2866 YP_001320675.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-41 42
Amet_2866 YP_001320675.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-39 42
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-46 42
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-46 42
Amet_2866 YP_001320675.1 two component transcriptional regulator CP000034.1.gene3834. Protein 1e-31 42
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002695.1.915041.p Protein 1e-31 42
Amet_2866 YP_001320675.1 two component transcriptional regulator AM180355.1.gene1830. Protein 6e-40 42
Amet_2866 YP_001320675.1 two component transcriptional regulator CP004022.1.gene1676. Protein 2e-36 42
Amet_2866 YP_001320675.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-35 42
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_2866 YP_001320675.1 two component transcriptional regulator VFG1563 Protein 1e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator VFG1702 Protein 2e-40 41
Amet_2866 YP_001320675.1 two component transcriptional regulator VFG1386 Protein 3e-39 41
Amet_2866 YP_001320675.1 two component transcriptional regulator VFG1389 Protein 3e-36 41