Gene Information

Name : Amet_3259 (Amet_3259)
Accession : YP_001321056.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3314803 - 3315501 bp
Length : 699 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: tte:TTE2474 response regulators consisting of a CheY-like receiver domain and a HTH DNA-binding domain

DNA sequence :
ATGGAAGCGAATAAGAAAAGGGTACTCATAATAGAAGACGAAAAAAACATTGCAGATGTCATTAAAGCATATTTACAAAA
TGAAAAATATGAGGCTATTGTGACACATAACGGTAAAGAGGCTATTAGCATTTTTCAACAGCAGTCATTTGATTTTGTCA
TATTAGATTTAATGCTACCGGATCTGTCTGGTGAAGAAATTTGCAAACGGATCAGACTACAGTCTCAGGTTCCAATATTA
ATGTTAACTGCAAAGGTAGAAGAAAGTGATCGGATTTATGGACTAGACATAGGTGCTGATGATTATATGACAAAGCCCTT
TAGTCCCAAAGAACTTGTGGCCAGGGTGAGGGCAATAATGAGAAGAACCAATAACGAAGGCCTTAAGGCTCATCTCATTG
AGCTAAATGGAGGGGATTTAAAGGTTGATCTAAGGGACATGGAGACCTGGAAAAAAGATGAACTAGTGGAATTAACTGCA
ACGGAATTTAAATTACTTTCTATTTTCATTCAAAATAGTGGCAAGGTATTTAGTCGTGATGAATTGGTTGTAAAGGTATT
AGGCTATGATTATGTCGGCTATGATCGGACAATTGATGTTCATATTAAGAATTTAAGACATAAAATTGAGTGTGAATATT
ATAAATACATTGTAACTGTCTATGGTGTTGGATATCGGTTTGTGAAGGTGTCATCATGA

Protein sequence :
MEANKKRVLIIEDEKNIADVIKAYLQNEKYEAIVTHNGKEAISIFQQQSFDFVILDLMLPDLSGEEICKRIRLQSQVPIL
MLTAKVEESDRIYGLDIGADDYMTKPFSPKELVARVRAIMRRTNNEGLKAHLIELNGGDLKVDLRDMETWKKDELVELTA
TEFKLLSIFIQNSGKVFSRDELVVKVLGYDYVGYDRTIDVHIKNLRHKIECEYYKYIVTVYGVGYRFVKVSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-35 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-37 44
Amet_3259 YP_001321056.1 two component transcriptional regulator CP000647.1.gene2531. Protein 1e-40 44
Amet_3259 YP_001321056.1 two component transcriptional regulator AM180355.1.gene1830. Protein 5e-31 43
Amet_3259 YP_001321056.1 two component transcriptional regulator CP000675.2.gene1535. Protein 2e-38 43
Amet_3259 YP_001321056.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-40 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 9e-33 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 9e-33 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator AE016830.1.gene1681. Protein 4e-40 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-38 42
Amet_3259 YP_001321056.1 two component transcriptional regulator BAC0596 Protein 6e-39 42
Amet_3259 YP_001321056.1 two component transcriptional regulator CP001138.1.gene2239. Protein 6e-39 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-40 42
Amet_3259 YP_001321056.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-40 42
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-42 41
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-41 41
Amet_3259 YP_001321056.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-42 41
Amet_3259 YP_001321056.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 8e-29 41
Amet_3259 YP_001321056.1 two component transcriptional regulator BAC0039 Protein 3e-40 41
Amet_3259 YP_001321056.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-40 41
Amet_3259 YP_001321056.1 two component transcriptional regulator CP001485.1.gene721.p Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_3259 YP_001321056.1 two component transcriptional regulator VFG1702 Protein 2e-35 41
Amet_3259 YP_001321056.1 two component transcriptional regulator VFG1563 Protein 8e-35 41