Gene Information

Name : Smed_0630 (Smed_0630)
Accession : YP_001326321.1
Strain : Sinorhizobium medicae WSM419
Genome accession: NC_009636
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 675487 - 676158 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sme:SMc00458 probable transcription regulator protein

DNA sequence :
ATGCGCATTCTGATCGTCGAGGACGATACCAATCTGAACAGGCAATTGGCTGAAGCGCTGAAGGAGGCAGGCTACGTCGT
CGATCAGGCCTATGACGGTGAGGAAGGCCATTATCTCGGCGATGCGGAACCGTATGATGCGGTCATTCTCGATATCGGCC
TTCCCGAGATGGACGGCATCACCGTGCTCGAGAAATGGCGCGCAGACGGCAAAACCATGCCGGTGCTGATCCTGACTGCC
CGCGACCGATGGAGCGATAAAGTCGCGGGAATCGATGCCGGCGCCGACGATTATGTGGCAAAACCCTTCCATGTGGAGGA
GGTGCTCGCCCGCATCCGTGCATTGATCCGCCGTGCCGCCGGGCATGCAAGCTCCGAGATCGTATGTGGCCCGGTCCGCC
TCGATACCAAGGGCTCCAAGGCGACTGTCGCAGGTGTGGCGTTGAAGCTCACATCGCACGAGTTCCGCCTGCTATCCTAT
CTCATGCACCATATGGGGCAGGTGGTTTCCCGCACAGAGCTCGTCGAGCATATGTATGATCAGGATTTCGATCGCGATTC
CAACACGATCGAGGTCTTCATCGGCAGGCTCCGCAAGAAGATCGGCAACGACCTCATCGAAACGGTGCGCGGTCTCGGAT
ATCGCATGCAAGCACCCGGCGATGGCCATTAG

Protein sequence :
MRILIVEDDTNLNRQLAEALKEAGYVVDQAYDGEEGHYLGDAEPYDAVILDIGLPEMDGITVLEKWRADGKTMPVLILTA
RDRWSDKVAGIDAGADDYVAKPFHVEEVLARIRALIRRAAGHASSEIVCGPVRLDTKGSKATVAGVALKLTSHEFRLLSY
LMHHMGQVVSRTELVEHMYDQDFDRDSNTIEVFIGRLRKKIGNDLIETVRGLGYRMQAPGDGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smed_0630 YP_001326321.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-38 47
Smed_0630 YP_001326321.1 two component transcriptional regulator CP000647.1.gene1136. Protein 7e-37 46
Smed_0630 YP_001326321.1 two component transcriptional regulator BAC0530 Protein 6e-37 46
Smed_0630 YP_001326321.1 two component transcriptional regulator CP004022.1.gene1005. Protein 3e-40 45
Smed_0630 YP_001326321.1 two component transcriptional regulator CP001918.1.gene2526. Protein 3e-36 45
Smed_0630 YP_001326321.1 two component transcriptional regulator BAC0487 Protein 4e-28 45
Smed_0630 YP_001326321.1 two component transcriptional regulator CP001138.1.gene1939. Protein 8e-37 44
Smed_0630 YP_001326321.1 two component transcriptional regulator CP000034.1.gene2022. Protein 7e-37 43
Smed_0630 YP_001326321.1 two component transcriptional regulator NC_002695.1.913289.p Protein 3e-36 43
Smed_0630 YP_001326321.1 two component transcriptional regulator BAC0347 Protein 3e-28 42
Smed_0630 YP_001326321.1 two component transcriptional regulator BAC0111 Protein 9e-32 42
Smed_0630 YP_001326321.1 two component transcriptional regulator BAC0197 Protein 5e-30 42
Smed_0630 YP_001326321.1 two component transcriptional regulator BAC0125 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smed_0630 YP_001326321.1 two component transcriptional regulator VFG0475 Protein 8e-37 44
Smed_0630 YP_001326321.1 two component transcriptional regulator VFG0473 Protein 1e-28 43
Smed_0630 YP_001326321.1 two component transcriptional regulator VFG0596 Protein 7e-28 42
Smed_0630 YP_001326321.1 two component transcriptional regulator VFG1389 Protein 3e-28 41