Gene Information

Name : merR2 (PSPA7_0101)
Accession : YP_001345497.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 111876 - 112310 bp
Length : 435 bp
Strand : -
Note : Annotation was generated automatically without manual curation; identified by match to protein family HMM PF00376; match to protein family HMM PF09278; match to protein family HMM TIGR02051

DNA sequence :
ATGGAAAACAATTTGGAGAACCTGACCATTGGCGTTTTCGCCAAGGCGGCCGGGGTCAATGTGGAGACCATCCGTTTCTA
TCAGCGCAAGGGCTTGTTGCTGGAGCCTGACAAGCCCTATGGCAGCATCCGCCGCTATGGCGAGGCGGATGTAACGCGGG
TGCGCTTCGTGAAATCAGCCCAGCGGCTGGGCTTCAGCCTGGATGAGATCGCCGAGCTGCTGCGGCTGGAGGATGGCACC
CATTGCGAGGAAGCCAGCAGTCTGGCCGAGCACAAGCTCAAGGACGTGCGCGAGAAAATGGCTGACCTGGCGCGCATGGA
GGCCGTGCTGTCTGAGTTGGTGTGCGCCTGCCATGCGCGAAGGGGGAACGTTTCCTGCCCGCTGATCGCGTCACTACAGG
GTGGAGCAAGCTTGGCAGGTTCGGCTATGCCTTAG

Protein sequence :
MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLLEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGT
HCEEASSLAEHKLKDVREKMADLARMEAVLSELVCACHARRGNVSCPLIASLQGGASLAGSAMP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-59 94
merR AGK07025.1 MerR Not tested SGI1 Protein 5e-59 94
merR AGK07083.1 MerR Not tested SGI1 Protein 5e-59 94
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-59 94
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-59 94
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-59 94
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-58 93
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-58 93
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-47 78
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-45 73
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 7e-28 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR2 YP_001345497.1 putative transcriptional regulator MerR BAC0687 Protein 2e-63 100
merR2 YP_001345497.1 putative transcriptional regulator MerR BAC0232 Protein 2e-63 100
merR2 YP_001345497.1 putative transcriptional regulator MerR BAC0688 Protein 6e-58 95
merR2 YP_001345497.1 putative transcriptional regulator MerR BAC0686 Protein 6e-56 95
merR2 YP_001345497.1 putative transcriptional regulator MerR BAC0684 Protein 5e-60 92
merR2 YP_001345497.1 putative transcriptional regulator MerR BAC0683 Protein 8e-60 91
merR2 YP_001345497.1 putative transcriptional regulator MerR BAC0689 Protein 6e-56 90