Name : PSPA7_2389 (PSPA7_2389) Accession : YP_001347756.1 Strain : Pseudomonas aeruginosa PA7 Genome accession: NC_009656 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 2429246 - 2429554 bp Length : 309 bp Strand : + Note : Annotation generated by automatically transferring the annotation from the manually curated GenBank accession AE004091; identified by match to protein family HMM PF01527 DNA sequence : ATGAGCAAGCAACGACGTACGTTTTCCGCCGAGTTCAAACGAGAGGCTGCCGCCTTGGTGCTGGACCAAGGCTACAGCCA TATCGACGCCTGCCGTTCGCTGGGGGTGGTGGACTCGGCCTTGCGCCGTTGGGTGAAGCAGCTCGAGGCGGAGCGCCAGG GTGTGACCCCGAAGAGCAAGGCGTTGACGCCTGAGCAGCAAAAGATCCAGGAGCTGGAAGCCCGGATCAACCGGCTGGAG CGGGAGAAAGCGATATTAAAAAAGGCTACCGCTCTCTTGATGTCGGACGAACTCGATCGTACGCGCTGA Protein sequence : MSKQRRTFSAEFKREAAALVLDQGYSHIDACRSLGVVDSALRRWVKQLEAERQGVTPKSKALTPEQQKIQELEARINRLE REKAILKKATALLMSDELDRTR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 6e-42 | 100 |
unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 6e-22 | 58 |
l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 8e-23 | 57 |
orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 8e-23 | 57 |
insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 1e-21 | 56 |
orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-22 | 56 |
VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 9e-22 | 56 |
VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 6e-22 | 56 |
orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 9e-22 | 56 |
orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-22 | 56 |
unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-22 | 56 |
orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-22 | 56 |
orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 6e-22 | 56 |
api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 5e-18 | 54 |
ECO111_3778 | YP_003236113.1 | putative IS602 transposase OrfA | Not tested | LEE | Protein | 7e-22 | 51 |
aec66 | AAW51749.1 | Aec66 | Not tested | AGI-3 | Protein | 5e-22 | 51 |
unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 2e-20 | 50 |
Z5088 | NP_290240.1 | hypothetical protein | Not tested | LEE | Protein | 2e-20 | 50 |
ECs4535 | NP_312562.1 | hypothetical protein | Not tested | LEE | Protein | 2e-20 | 50 |
unnamed | AAC31483.1 | L0004 | Not tested | LEE | Protein | 2e-20 | 50 |
ORF SG13 | AAN62235.1 | conserved hypothetical protein | Not tested | PAGI-3(SG) | Protein | 9e-14 | 43 |
unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 3e-11 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
PSPA7_2389 | YP_001347756.1 | hypothetical protein | VFG1553 | Protein | 2e-22 | 58 |
PSPA7_2389 | YP_001347756.1 | hypothetical protein | VFG1485 | Protein | 3e-23 | 57 |
PSPA7_2389 | YP_001347756.1 | hypothetical protein | VFG1123 | Protein | 3e-22 | 56 |
PSPA7_2389 | YP_001347756.1 | hypothetical protein | VFG0784 | Protein | 6e-21 | 50 |
PSPA7_2389 | YP_001347756.1 | hypothetical protein | VFG1566 | Protein | 1e-11 | 41 |