
|
Name : ureA (PSPA7_5586) Accession : YP_001350907.1 Strain : Pseudomonas aeruginosa PA7 Genome accession: NC_009656 Putative virulence/resistance : Virulence Product : urease subunit gamma Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0831 EC number : - Position : 5755947 - 5756249 bp Length : 303 bp Strand : + Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter DNA sequence : ATGGACTTGTCCCCCCGCGAGAAAGACAAGCTGCTGATCTTCACCGCCGGCCTGCTCGCCGAGCGCCGGCTGGCGCGTGG TCTCAAGCTGAACTACCCGGAGGCGGTGGCGCTGATCTCCGCCGCCCTGCTGGAAGGCGCGCGCGACGGCCGCAGCGTCG CCGAGCTGATGCACTACGGCACCACCCTGCTGAGCCGCGAACAGGTGATGGAGGGCGTGCCGGAGATGATCCCGGACATC CAGGTGGAGGCCACCTTCCCCGACGGCACCAAGCTGGTGACCGTCCACCAGCCCATCGCCTGA Protein sequence : MDLSPREKDKLLIFTAGLLAERRLARGLKLNYPEAVALISAALLEGARDGRSVAELMHYGTTLLSREQVMEGVPEMIPDI QVEATFPDGTKLVTVHQPIA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ureA | NP_286678.1 | urease subunit gamma | Virulence | TAI | Protein | 9e-23 | 82 |
| ureA | NP_287086.1 | urease subunit gamma | Not tested | TAI | Protein | 9e-23 | 82 |
| ureA | YP_005684268.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-24 | 70 |
| ureA | YP_003784327.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-24 | 70 |
| ureA | YP_005686360.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-24 | 70 |
| ureA | YP_005682176.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-24 | 70 |