Gene Information

Name : copR2 (mma_1722)
Accession : YP_001353412.1
Strain : Janthinobacterium sp. Marseille
Genome accession: NC_009659
Putative virulence/resistance : Virulence
Product : response regulator of copper sensing system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1950992 - 1951684 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGAAATTATTAATCGTTGAAGACGAAGTAAAGACTGGCGAGTACCTACAGCAGGGGCTTATGGAAGCTGGCTTTGCCGT
GGATTACGCTAATAATGGACTGGACGGGCATCATCTCGCCGTTACCGGAAGCTACGACCTTATCATCTTAGATGTGATGC
TACCGGATATAGACGGATGGAAGATATTGCATGCATTGCGCAGTGCCGGAAACAGTGTTCCAGCTCTCTTTCTAACCGCC
CGAGACGGCGTAGCGGATAGAGTAAAAGGTCTTGAGCTAGGCGCTGACGACTACATGGTTAAACCATTCGCGTTCTCAGA
ATTGCTAGCCCGAGTGAGGACATTGCTGCGAAGAGGGAATCCCAGCCCGCTAGTGGATAGGCTACAAGTATCTGATTTAG
TCCTCGATCTTGCCCGGCGAGCGGCTACTCGTGCAGGGAAACGTCTAACCCTGACTAATAAGGAGTTTCTTCTATTGGAA
TTTTTAGTAAGACACAAAGGCGAAGTTCTACCCCGCTCTCTTATCGCCTCCCAAATTTGGGATATTAATTTTAATAGCGA
CACGAATGTTATTGATGTCGCTATTCGCCGCTTACGCGCCAAAATGGATGACGATTACGATCCGAAGTTAATCTCCACGA
TTCGGGGCGTCGGATATGTTCTGGAAGATCCAGCAGATGCCAGAGGCGTGTAA

Protein sequence :
MKLLIVEDEVKTGEYLQQGLMEAGFAVDYANNGLDGHHLAVTGSYDLIILDVMLPDIDGWKILHALRSAGNSVPALFLTA
RDGVADRVKGLELGADDYMVKPFAFSELLARVRTLLRRGNPSPLVDRLQVSDLVLDLARRAATRAGKRLTLTNKEFLLLE
FLVRHKGEVLPRSLIASQIWDINFNSDTNVIDVAIRRLRAKMDDDYDPKLISTIRGVGYVLEDPADARGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-60 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-60 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR2 YP_001353412.1 response regulator of copper sensing system BAC0111 Protein 8e-76 68
copR2 YP_001353412.1 response regulator of copper sensing system BAC0083 Protein 3e-71 66
copR2 YP_001353412.1 response regulator of copper sensing system BAC0197 Protein 2e-65 65
copR2 YP_001353412.1 response regulator of copper sensing system BAC0347 Protein 3e-69 64
copR2 YP_001353412.1 response regulator of copper sensing system BAC0638 Protein 3e-64 63
copR2 YP_001353412.1 response regulator of copper sensing system BAC0308 Protein 2e-65 61
copR2 YP_001353412.1 response regulator of copper sensing system BAC0125 Protein 4e-62 59
copR2 YP_001353412.1 response regulator of copper sensing system NC_007622.3794948.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system NC_003923.1003417.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system NC_013450.8614146.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system NC_002951.3238224.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system NC_007793.3914065.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system NC_002758.1121390.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system NC_010079.5776364.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system NC_002952.2859858.p0 Protein 2e-34 42
copR2 YP_001353412.1 response regulator of copper sensing system BAC0487 Protein 8e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR2 YP_001353412.1 response regulator of copper sensing system VFG0596 Protein 6e-61 56
copR2 YP_001353412.1 response regulator of copper sensing system VFG1389 Protein 3e-35 43
copR2 YP_001353412.1 response regulator of copper sensing system VFG1390 Protein 3e-43 42
copR2 YP_001353412.1 response regulator of copper sensing system VFG1386 Protein 5e-37 42
copR2 YP_001353412.1 response regulator of copper sensing system VFG0473 Protein 2e-31 41