Gene Information

Name : czcR2 (mma_2354)
Accession : YP_001354044.1
Strain : Janthinobacterium sp. Marseille
Genome accession: NC_009659
Putative virulence/resistance : Resistance
Product : heavy metal response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2639212 - 2639883 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
ATGAAAATTCTTTTGGTCGAAGATGAAGTCAAGTCCGGTGAGTACCTGCGCAAAGGTTTGCGCGAAGCAGGTTTCGTGGT
GGATTGGGCACGGGACGGGGCAGAGGGTTTGCAGCTGGCGCTACAGGAAAGCTATGAACTGGTCATCCTTGATGTCATGT
TGCCGCTGCTTGATGGCTGGCAATTGCTGCGCGAATTGCGCAAGGTACGTGATACACCGGTGCTCTTTCTCACAGCACGT
GATGAAGTAGAGGACAGGGTGAAAGGCCTAGAGCTGGGCGCGGATGACTATCTGGTCAAACCGTTTTCCTTTATGGAATT
GATTGCCCGTGTACGGACTTTGCTGAGGCGCGGCCCGGTGCGGGAATCCAGCCTGATCGAAATTGCAGACATGCAGATTG
ATGTCATGAAGCGCCGTGTGACACGCAATGGCGAACGGCTGGACCTGACTGCGAAAGAATTTTCGCTATTGCATTTGCTG
GCACAGCGTCGCGGTGAAGTATTGTCGCGTTCGCTAATCGCGTCGCAAGTGTGGGATATGAATTTCGACAGCGATACCAA
TGTAGTGGATGTTGCGATACGCCGCCTGCGCGCCAAACTGGATGATCCGCATCCGCGCAAATTGATACAGACCGTGCGCG
GCATCGGCTATGTGTTGGAGGAGGGCGAATGA

Protein sequence :
MKILLVEDEVKSGEYLRKGLREAGFVVDWARDGAEGLQLALQESYELVILDVMLPLLDGWQLLRELRKVRDTPVLFLTAR
DEVEDRVKGLELGADDYLVKPFSFMELIARVRTLLRRGPVRESSLIEIADMQIDVMKRRVTRNGERLDLTAKEFSLLHLL
AQRRGEVLSRSLIASQVWDMNFDSDTNVVDVAIRRLRAKLDDPHPRKLIQTVRGIGYVLEEGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-61 62
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-59 61
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-35 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR2 YP_001354044.1 heavy metal response regulator BAC0197 Protein 2e-69 66
czcR2 YP_001354044.1 heavy metal response regulator BAC0083 Protein 6e-67 64
czcR2 YP_001354044.1 heavy metal response regulator BAC0125 Protein 3e-67 63
czcR2 YP_001354044.1 heavy metal response regulator BAC0638 Protein 3e-59 63
czcR2 YP_001354044.1 heavy metal response regulator BAC0111 Protein 4e-64 61
czcR2 YP_001354044.1 heavy metal response regulator BAC0308 Protein 7e-64 61
czcR2 YP_001354044.1 heavy metal response regulator BAC0347 Protein 6e-59 58
czcR2 YP_001354044.1 heavy metal response regulator AE015929.1.gene1106. Protein 6e-37 45
czcR2 YP_001354044.1 heavy metal response regulator NC_002952.2859905.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_002758.1121668.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_009641.5332272.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_013450.8614421.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_007793.3914279.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_002745.1124361.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_007622.3794472.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_009782.5559369.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_002951.3237708.p0 Protein 1e-34 45
czcR2 YP_001354044.1 heavy metal response regulator NC_003923.1003417.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_013450.8614146.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_002951.3238224.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_007793.3914065.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_002758.1121390.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_010079.5776364.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_002952.2859858.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_007622.3794948.p0 Protein 4e-42 44
czcR2 YP_001354044.1 heavy metal response regulator NC_003923.1003749.p0 Protein 2e-34 44
czcR2 YP_001354044.1 heavy metal response regulator HE999704.1.gene1528. Protein 1e-31 43
czcR2 YP_001354044.1 heavy metal response regulator AE000516.2.gene3505. Protein 3e-30 43
czcR2 YP_001354044.1 heavy metal response regulator AF310956.2.orf0.gene Protein 2e-35 41
czcR2 YP_001354044.1 heavy metal response regulator U35369.1.gene1.p01 Protein 1e-34 41
czcR2 YP_001354044.1 heavy metal response regulator AE016830.1.gene2255. Protein 1e-34 41
czcR2 YP_001354044.1 heavy metal response regulator BAC0487 Protein 4e-28 41
czcR2 YP_001354044.1 heavy metal response regulator NC_012469.1.7685629. Protein 1e-32 41
czcR2 YP_001354044.1 heavy metal response regulator HE999704.1.gene2815. Protein 3e-34 41
czcR2 YP_001354044.1 heavy metal response regulator CP001918.1.gene5135. Protein 9e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR2 YP_001354044.1 heavy metal response regulator VFG0596 Protein 3e-61 62
czcR2 YP_001354044.1 heavy metal response regulator VFG1389 Protein 2e-38 47
czcR2 YP_001354044.1 heavy metal response regulator VFG1390 Protein 3e-38 43
czcR2 YP_001354044.1 heavy metal response regulator VFG1386 Protein 5e-34 42