Gene Information

Name : Krad_0896 (Krad_0896)
Accession : YP_001360648.1
Strain : Kineococcus radiotolerans SRS30216
Genome accession: NC_009664
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1395200 - 1395880 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sma:SAV3972 two-component system response regulator

DNA sequence :
GTGACGCGCATCCTGGTGGTCGAGGACGAGGAGTCGTTCTCCGACCCGCTGTCCTACCTGCTGCGGCGGGAGGGGTACGA
CGTGGCGGTGACCGAGACCGGCCCCGAGGCGCTGGAGGAGTTCGACAAGGCCGGGGCGGACCTGGTCCTGCTGGACCTCA
TGCTGCCGGGTCTGCCCGGCACGGAGGTCTGCCGCCAGCTGCGCACCCGCTCCAGCGTGCCGGTCATCATGCTGACCGCG
AAGGACTCCGAGATCGACAAGGTCGTGGGCCTGGAGATCGGGGCCGACGACTACGTCACCAAGCCGTACTCCTCGCGCGA
GCTGCTGGCCCGGGTGCGGGCGGTGCTGCGGCGCGGGGCCGAGCCCGAGGACCTCGTGCAGACGACGGTCGAGGCGGGCG
GGGTGCGGATGGACGTGGACCGCCACGTGGTGACCGTGCGGGGCGAGCGGGTGCCCCTGCCGCTGAAGGAGTTCGAGCTG
CTGGAGCTGCTGCTGCGCAACGCGGGCCGGGTGCTGACCCGGGTCCAGCTCATCGACCGCGTCTGGGGTTCCGACTACGT
GGGCGACACCAAGACCCTCGACGTCCACGTGAAACGGCTGCGGGCGAAGATCGAGCCCGACCCCGCCAACCCGCGGCACC
TGGTGACGGTGCGCGGGCTGGGGTACAAGTTCGAGGGCTGA

Protein sequence :
MTRILVVEDEESFSDPLSYLLRREGYDVAVTETGPEALEEFDKAGADLVLLDLMLPGLPGTEVCRQLRTRSSVPVIMLTA
KDSEIDKVVGLEIGADDYVTKPYSSRELLARVRAVLRRGAEPEDLVQTTVEAGGVRMDVDRHVVTVRGERVPLPLKEFEL
LELLLRNAGRVLTRVQLIDRVWGSDYVGDTKTLDVHVKRLRAKIEPDPANPRHLVTVRGLGYKFEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-15 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-29 50
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-30 46
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-28 46
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-29 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-28 45
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-17 44
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-27 44
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-14 43
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-29 43
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-18 43
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-12 42
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-16 42
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-11 42
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-15 41
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 9e-25 41
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-18 41
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-16 41
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 6e-17 41
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-18 41
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-18 41
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-15 44
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-19 43
Krad_0896 YP_001360648.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-13 41