Gene Information

Name : Bcer98_1021 (Bcer98_1021)
Accession : YP_001374342.1
Strain : Bacillus cytotoxicus NVH 391-98
Genome accession: NC_009674
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1138480 - 1139151 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bce:BC1300 two-component response regulator

DNA sequence :
ATGAACAAATATAAAGTATTACTTGTTGATGACGAGAGTGATATGAGGCAACTTGTTGGTATGTACTTAGACAACTTTGG
TTATGAATGGGATGAAGCGGAAAATGGAAAAGAGGCACTTTTAAAATTAGAAGAGGCGCATTATGATTTTGTTATTTTAG
ATATTATGATGCCAGAGATGGATGGAATTGCCGTTTGTAAAGAAATTAGGAAAACATCAGATATTCCGATTATTTTTTTA
ACGGCTAAGGGAGAAGAATGGAATCGAGTAAATGGTTTACGAAATGGTGCGGATGATTATGTTGTGAAGCCATTTAGTCC
CGGGGAGCTGATTGCACGCATGGAAGCTGTACTCAGACGATATACAAAGCAAGGGCAACAAGAAGAATTGGAATTTGGCC
CAATACGTATGAATGAAAAAAGCAGGAAGGCTGAAACGAACGGAAAAATCATTTCCCTTACAGTAAAAGAATTTGATTTA
TTATATTTTCTTTGCCAGCACCATGGCCAAGTATTTAGCCGAGAGCAGTTATTAGAGAAAGTATGGGGATATGACTATGC
AGGAAGTACAAGAACGGTGGATACACATGTGAAAACAATGCGTTTGAAACTAGGAGAAAGCGGAAACTGCATCCAAACAG
TTTGGGGTGTAGGATATAAATTTGAGGTGTAA

Protein sequence :
MNKYKVLLVDDESDMRQLVGMYLDNFGYEWDEAENGKEALLKLEEAHYDFVILDIMMPEMDGIAVCKEIRKTSDIPIIFL
TAKGEEWNRVNGLRNGADDYVVKPFSPGELIARMEAVLRRYTKQGQQEELEFGPIRMNEKSRKAETNGKIISLTVKEFDL
LYFLCQHHGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNCIQTVWGVGYKFEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-39 45
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-38 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-42 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-43 42
Bcer98_1021 YP_001374342.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-44 42
Bcer98_1021 YP_001374342.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-38 42
Bcer98_1021 YP_001374342.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-25 42
Bcer98_1021 YP_001374342.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 3e-33 41
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-37 41
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-37 41
Bcer98_1021 YP_001374342.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcer98_1021 YP_001374342.1 two component transcriptional regulator VFG1389 Protein 2e-33 43
Bcer98_1021 YP_001374342.1 two component transcriptional regulator VFG1702 Protein 5e-35 42
Bcer98_1021 YP_001374342.1 two component transcriptional regulator VFG1563 Protein 2e-35 41