Gene Information

Name : Bcer98_3274 (Bcer98_3274)
Accession : YP_001376488.1
Strain : Bacillus cytotoxicus NVH 391-98
Genome accession: NC_009674
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3342678 - 3343394 bp
Length : 717 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bce:BC4589 alkaline phosphatase synthesis two-component response regulator PhoP

DNA sequence :
ATGAGCAATCGAATTTTAGTTGTTGATGATGAAGAGTTTATCCTAACTTTAATTGAGTTTAATTTACAGCAGGCTGGTTT
TGAAGTGATCACAGCAATGGATGGTGAAGTTGCGTTTCAAAAGGCGACAACAGAGCGTCCAGATTTGATTATATTAGATT
TAATGCTTCCAAAGATGGATGGAATGGAAGTATGTAAGGAGTTACGTTTGCAGCGCGTTATGACACCTATTCTTATGCTA
ACTGCAAAAGATGATGAATTTGATAAAGTACTAGGGCTTGAGCTTGGAGCCGATGATTATATGACGAAGCCGTTTAGCCC
GAGGGAAGTTGTTGCACGAGTGAAGGCAATTTTACGTCGAACAAAGTTGCAGGAAGAACAAATTCCGGAAGTGCCAGATG
AAAATAGCATTATGATTTCTGAACTAAAGATTTTACCAGAATTTTATGAGGCATATTTCAGAGGAGAAAAATTAGAACTT
ACTCCGAAAGAGTTTGAATTACTTGTTTATCTTGCGAGGAATAAAGGGCGAGTATTAACGCGCGATCAATTATTAAGCGC
GGTATGGAATTATGATTTCGCTGGTGATACGAGAATTGTTGATGTTCATATTAGTCATCTGCGCGATAAAATAGAGCACA
ATACAAAAAAACCAGCGTATATTAAGACAATTCGAGGATTAGGTTATAAATTAGAGGAGCCAAAAGGAGATGAATAA

Protein sequence :
MSNRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEVAFQKATTERPDLIILDLMLPKMDGMEVCKELRLQRVMTPILML
TAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILRRTKLQEEQIPEVPDENSIMISELKILPEFYEAYFRGEKLEL
TPKEFELLVYLARNKGRVLTRDQLLSAVWNYDFAGDTRIVDVHISHLRDKIEHNTKKPAYIKTIRGLGYKLEEPKGDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-35 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcer98_3274 YP_001376488.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-75 65
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-74 64
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-59 55
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-63 55
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_012469.1.7685629. Protein 5e-53 53
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP001485.1.gene721.p Protein 2e-35 45
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-31 45
Bcer98_3274 YP_001376488.1 two component transcriptional regulator BAC0197 Protein 5e-29 44
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-40 44
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002695.1.915041.p Protein 2e-33 44
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP000647.1.gene4257. Protein 5e-34 44
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP000034.1.gene3834. Protein 2e-33 44
Bcer98_3274 YP_001376488.1 two component transcriptional regulator BAC0533 Protein 5e-34 44
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-34 43
Bcer98_3274 YP_001376488.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-39 43
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP001138.1.gene4273. Protein 1e-33 43
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-36 43
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 2e-35 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 9e-34 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AE016830.1.gene2255. Protein 9e-34 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-39 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-39 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-37 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator BAC0039 Protein 1e-36 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator BAC0596 Protein 1e-35 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-36 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP000034.1.gene2186. Protein 1e-36 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-35 42
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AE015929.1.gene1106. Protein 9e-36 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-38 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-37 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 6e-39 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-31 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP004022.1.gene1676. Protein 2e-32 41
Bcer98_3274 YP_001376488.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcer98_3274 YP_001376488.1 two component transcriptional regulator VFG1389 Protein 2e-33 44
Bcer98_3274 YP_001376488.1 two component transcriptional regulator VFG1386 Protein 7e-40 43
Bcer98_3274 YP_001376488.1 two component transcriptional regulator VFG1390 Protein 4e-35 41