Gene Information

Name : Anae109_0880 (Anae109_0880)
Accession : YP_001378073.1
Strain : Anaeromyxobacter sp. Fw109-5
Genome accession: NC_009675
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1007071 - 1007775 bp
Length : 705 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ade:Adeh_2914 two component transcriptional regulator, winged helix family

DNA sequence :
GTGACCGCCACGACGCCCGATCTCGTCCTCCTCGTCGAGGACGACCGCCGGCTCGCCGACCTGACCCGCGAGTACCTCGA
GGGCCACGGCCTCGCCGTGGTGCACGTCGCCGACGGCCGGCGCGGCCTCGAGGAGGCGCTCTCGGGCCGGTACGAGGCGG
TGCTGCTCGACCTCATGCTGCCCGGCAAGGACGGCCTCGAGGTCTGCCGCGAGCTGCGCGCCCGCTCCGACGTGCCCGTC
ATCGTGCTCACCGCGCGGGGCGAGGAGGCGGACCGCGTGCTCGGGCTCGAGCTGGGGGCGGACGACTACCTCGCGAAGCC
GTTCTCGCCCCGCGAGCTGCTCGCGCGCATCCGGGCGATCGTCCGCCGCGCGCGCGGCCGCGCCGGGCCGGCCGCGTCGA
CGCTGCGCGTGGGCGGCCTCGTCGTCGATCCCGGGGCGCGGCGGGTGACGCTCGACGGCCGCGAGATCGCGCTCACCGGC
TACGAGTTCGCGCTGCTCGACGCGCTCGCGCGCCGCGCCGGGCGCGTCCTGTCGCGCGAGCAGCTCATGGAGCTCGCCGG
CGGCAGCGCGGAGGAGGCCTTCGACCGGTCCATCGACGTCCACGTGTCGCGGCTCCGCCAGAAGCTCGGCGACGATCCGA
AGCGCCCGCGCCTCATCAAGACCGTGCGCGGCGCCGGCTACCTGCTCGCGGCGGAGGGGGAGTGA

Protein sequence :
MTATTPDLVLLVEDDRRLADLTREYLEGHGLAVVHVADGRRGLEEALSGRYEAVLLDLMLPGKDGLEVCRELRARSDVPV
IVLTARGEEADRVLGLELGADDYLAKPFSPRELLARIRAIVRRARGRAGPAASTLRVGGLVVDPGARRVTLDGREIALTG
YEFALLDALARRAGRVLSREQLMELAGGSAEEAFDRSIDVHVSRLRQKLGDDPKRPRLIKTVRGAGYLLAAEGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-20 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-20 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_008702.1.4607594. Protein 7e-35 47
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP001485.1.gene721.p Protein 3e-23 46
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-25 46
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP000034.1.gene3834. Protein 1e-25 46
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP000647.1.gene4257. Protein 3e-25 46
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002695.1.915041.p Protein 1e-25 46
Anae109_0880 YP_001378073.1 two component transcriptional regulator BAC0533 Protein 3e-25 46
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP004022.1.gene3215. Protein 7e-28 45
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP001138.1.gene4273. Protein 6e-25 45
Anae109_0880 YP_001378073.1 two component transcriptional regulator BAC0083 Protein 5e-21 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-33 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator BAC0638 Protein 1e-18 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP000034.1.gene3671. Protein 6e-31 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-26 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator AE016830.1.gene1681. Protein 7e-27 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator BAC0308 Protein 5e-18 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-27 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator BAC0125 Protein 3e-20 43
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-26 43
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-26 43
Anae109_0880 YP_001378073.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-25 43
Anae109_0880 YP_001378073.1 two component transcriptional regulator BAC0111 Protein 3e-20 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-24 42
Anae109_0880 YP_001378073.1 two component transcriptional regulator BAC0347 Protein 6e-19 41
Anae109_0880 YP_001378073.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-26 41
Anae109_0880 YP_001378073.1 two component transcriptional regulator CP000647.1.gene2531. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Anae109_0880 YP_001378073.1 two component transcriptional regulator VFG0596 Protein 4e-21 45
Anae109_0880 YP_001378073.1 two component transcriptional regulator VFG1389 Protein 5e-20 45
Anae109_0880 YP_001378073.1 two component transcriptional regulator VFG1390 Protein 3e-22 44
Anae109_0880 YP_001378073.1 two component transcriptional regulator VFG1702 Protein 6e-27 41