Gene Information

Name : Xaut_3517 (Xaut_3517)
Accession : YP_001418403.1
Strain : Xanthobacter autotrophicus Py2
Genome accession: NC_009720
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3918834 - 3919550 bp
Length : 717 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bra:BRADO2742 putative two-component transcriptional regulator; putative transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis

DNA sequence :
ATGACAGCGAATCTCGATCCGGATCCCCTCACTGCCATGCGCCTCCTCCTTGTCGAGGACGACCGCGACGCCGCCGAATA
TCTGCGCAAGGCCTTCCGCGAGGCTGGGCACGTGGTGGACCTTGCTGCCGACGGGGAGGAGGGCCTCGCCCTCGCCCTGG
ACGGCAAGTACGACGTGATGGTGGTAGACCGCATGCTGCCCGCGCGCGACGGGCTCTCCCTCGTCACCGAGCTGCGCGGG
CGCGGGCACACCACGCCAGTGCTCATCCTTTCCGCCCTCGGCCAGGTGGACGACCGGGTGCAGGGCCTGCGCGCCGGCGG
TGACGACTACCTGCCCAAGCCCTACGCCTTCACCGAGCTTCTGGCGCGGGTGGAAGCCCTGTCGCGGCGCGGCGTCTCGC
AAGGCGCGGAGACGGTCTACAAGGTGTCCGACCTGGAGCTGGACCGTCTTGCCCATCGCGTCACCCGCTCCGGCAAGGAG
ATCCCGCTGCAGCCGCGGGAGTTCCGGCTGCTGGAATATCTCCTGCGCCATGCCGGGCAGGTGGTGACCCGCACCATGCT
GCTGGAAAACGTGTGGGACTACCATTTCGACCCACAGACCAACGTCATCGACGTGCACGTCTCCCGCCTGCGCTCCAAGA
TCGACAAGGGCTTCGACGTGCCGCTGATCCACACCGTGCGCGGCGCCGGCTACATGGTGCGGGCGGGTGCCGCTTGA

Protein sequence :
MTANLDPDPLTAMRLLLVEDDRDAAEYLRKAFREAGHVVDLAADGEEGLALALDGKYDVMVVDRMLPARDGLSLVTELRG
RGHTTPVLILSALGQVDDRVQGLRAGGDDYLPKPYAFTELLARVEALSRRGVSQGAETVYKVSDLELDRLAHRVTRSGKE
IPLQPREFRLLEYLLRHAGQVVTRTMLLENVWDYHFDPQTNVIDVHVSRLRSKIDKGFDVPLIHTVRGAGYMVRAGAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-37 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xaut_3517 YP_001418403.1 two component transcriptional regulator BAC0111 Protein 6e-51 51
Xaut_3517 YP_001418403.1 two component transcriptional regulator BAC0308 Protein 6e-43 49
Xaut_3517 YP_001418403.1 two component transcriptional regulator BAC0125 Protein 4e-44 48
Xaut_3517 YP_001418403.1 two component transcriptional regulator BAC0083 Protein 5e-47 48
Xaut_3517 YP_001418403.1 two component transcriptional regulator BAC0638 Protein 6e-40 48
Xaut_3517 YP_001418403.1 two component transcriptional regulator BAC0347 Protein 8e-45 48
Xaut_3517 YP_001418403.1 two component transcriptional regulator BAC0197 Protein 6e-43 46
Xaut_3517 YP_001418403.1 two component transcriptional regulator NC_002516.2.879194.p Protein 6e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xaut_3517 YP_001418403.1 two component transcriptional regulator VFG0596 Protein 1e-37 45
Xaut_3517 YP_001418403.1 two component transcriptional regulator VFG1389 Protein 2e-32 45
Xaut_3517 YP_001418403.1 two component transcriptional regulator VFG1390 Protein 4e-37 43
Xaut_3517 YP_001418403.1 two component transcriptional regulator VFG0473 Protein 6e-27 43