Gene Information

Name : yceC (RBAM_003150)
Accession : YP_001419945.1
Strain : Bacillus amyloliquefaciens FZB42
Genome accession: NC_009725
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 287299 - 287895 bp
Length : 597 bp
Strand : +
Note : tellurium resistance protein YceC

DNA sequence :
ATGGCGATCTCTTTACAAAAAGGACAGCGGATTGATTTAACAAAAGGAAAAGCCGGTCTGTCAAAACTGCTGGTCGGACT
CGGCTGGGACCCTGTATCATCCGGGGGCTTTTTCGGAAAGCTGTTCGGCGGAGGCGGTGCCAATATCGACTGTGACGCTT
CCGTACTGATGCTTGAAAATGATAAAATGACAGACAGTAAAAACGTCATCTATTTCGGTAATCTGAAAAGCCGATGCGGC
GGTGTCGTACACACGGGTGACAACCTGACGGGAGAAGGCGACGGCGATGATGAACAAATTCTCATCGATTTGGCGAAAGT
CCCCGCTCAGATTAATAAACTTGTGTTTGTCGTCAATATTTACGACTGCGTCAGACGAAAACAGGACTTCGGCATGATTC
AAAACGCGTTCATCCGCGTCGTTGATCAGGCTAACCGCGAAGAACTGGTGACTTACAATTTAAGAGATAACTATTCAGGC
AGAACGAGCCTGATCGCGGCTGAAATCTACCGCGAGGACGGCGAGTGGAAATTCGCTGCGATAGGTGAAGGCACAAACGA
TACGAAAATCGGCGATATCGTTAACCGATACGCCTAA

Protein sequence :
MAISLQKGQRIDLTKGKAGLSKLLVGLGWDPVSSGGFFGKLFGGGGANIDCDASVLMLENDKMTDSKNVIYFGNLKSRCG
GVVHTGDNLTGEGDGDDEQILIDLAKVPAQINKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQANREELVTYNLRDNYSG
RTSLIAAEIYREDGEWKFAAIGEGTNDTKIGDIVNRYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-36 46
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-33 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-32 45
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-32 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-28 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-28 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-28 44
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-30 43
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-34 43
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-34 43
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceC YP_001419945.1 hypothetical protein BAC0390 Protein 5e-34 45
yceC YP_001419945.1 hypothetical protein BAC0392 Protein 4e-28 43
yceC YP_001419945.1 hypothetical protein BAC0389 Protein 3e-33 43