Gene Information

Name : Rcas_0997 (Rcas_0997)
Accession : YP_001431123.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1302663 - 1303355 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_3818 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCATATGTCCACCATTCTGCTGGTAGAAGATGATCCGATTCTCTCGGAAACGCTGCGGTACAATTTGGAGCGGGAAGG
ATATTCGGTTATCAATGCTGTCGATGGCGTGGCAGGTCTCGAACGGGCGCGACGCGACCAACCCGATATGGTCATTCTCG
ACGTGATGCTGCCGCGCCTTGATGGATTCTCCGTCTGCCGCATTCTGCGCCAGGAGAGCGAGGTGCCTATTCTGATCCTG
ACGGCGCGGCAGGACGAAATTGATCGCATTGCGGGACTGGAGTTGGGCGCCGATGATTATGTCGCCAAACCGTTCAGCCT
GGGTGAACTGTTGGCGCGGGTGCGCGCAATTATGCGCCGCTCTGAACGACGGATCGGCATGATGCGCGAGGTGCTCGATG
CCGGTTCGCTCCGGGTCGATACCGGTTCACGACGCGCCTGGCGAGATAATGTGGAGTTGAATCTGTCCCAAAAAGAGTTC
GATCTGTTGGTCTGCCTGATGCGCAATCGCAGTATGGCGCTGTCGCGCGATATGCTGCTCGAGCGGGTATGGGGGTACGA
CTTTCTCGGCGATAGCCGAACTGTCGATGTGCATATTCGCTGGTTGCGCGAAAAGGTCGAACCTGATCCGAGCAGGCCGG
TGTATATCCATACGGTGCGCGGCATTGGCTACCGCTTTGAAGCGCCCAACTGA

Protein sequence :
MHMSTILLVEDDPILSETLRYNLEREGYSVINAVDGVAGLERARRDQPDMVILDVMLPRLDGFSVCRILRQESEVPILIL
TARQDEIDRIAGLELGADDYVAKPFSLGELLARVRAIMRRSERRIGMMREVLDAGSLRVDTGSRRAWRDNVELNLSQKEF
DLLVCLMRNRSMALSRDMLLERVWGYDFLGDSRTVDVHIRWLREKVEPDPSRPVYIHTVRGIGYRFEAPN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_0997 YP_001431123.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-52 48
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-51 47
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-50 46
Rcas_0997 YP_001431123.1 two component transcriptional regulator BAC0125 Protein 3e-37 45
Rcas_0997 YP_001431123.1 two component transcriptional regulator BAC0197 Protein 1e-35 45
Rcas_0997 YP_001431123.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-41 45
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-46 44
Rcas_0997 YP_001431123.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-49 44
Rcas_0997 YP_001431123.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-37 43
Rcas_0997 YP_001431123.1 two component transcriptional regulator BAC0083 Protein 3e-36 42
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-41 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 3e-37 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 3e-37 41
Rcas_0997 YP_001431123.1 two component transcriptional regulator CP000675.2.gene1535. Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_0997 YP_001431123.1 two component transcriptional regulator VFG1389 Protein 3e-40 46
Rcas_0997 YP_001431123.1 two component transcriptional regulator VFG1390 Protein 3e-41 45
Rcas_0997 YP_001431123.1 two component transcriptional regulator VFG0596 Protein 8e-31 42
Rcas_0997 YP_001431123.1 two component transcriptional regulator VFG1702 Protein 1e-36 42
Rcas_0997 YP_001431123.1 two component transcriptional regulator VFG1386 Protein 1e-40 42
Rcas_0997 YP_001431123.1 two component transcriptional regulator VFG1563 Protein 9e-37 41