Gene Information

Name : Rcas_2487 (Rcas_2487)
Accession : YP_001432585.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3203343 - 3204017 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_2290 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAGCGCCATTTTAATCGTCGAAGACGAGGCCGAAATTGCCGGCTACCTCCGGCGCGGGCTGACATTCGAAGGGTACAA
CGTCGAAATCGCCGCCGATGGTCGTCAGGCGCTCGAGATCGCGCGCGAACGTCCGCCCGATCTCGTGGTGCTCGACCTGA
TGCTGCCGGGCATCGACGGGCTTGAAGTTGCGCGCCGCCTCCGTGCTGCGTCGGATGTGCCGATTATCATGCTCACGGCG
CGCGACGCCGTCCCGGATCGCGTTGCCGGTCTTGAAGCCGGCGCCGACGATTATCTGATCAAACCGTTCGCTTTTGAGGA
GTTGCTGGCGCGCATTCGCGTCCAATTGCGCCGCCGTCAACGCGAAGACACAGCGACGGTGCTGCGCTATGGTCCGCTGA
CCATGGATCTTACCGCTCACGAAGTCACCATTGGCGACCGGCGGGTGGATCTCACGGCAAAGGAATATGATCTGCTCGAA
TTGTTCATGCGCCACCCACAACAGGTGATGACGCGCGATGTCATCTACGACCGCGTGTGGGGGTACAATTTCGGCGGCGA
AAGCAACATCATCGAAGTCTACGTGCGCTACCTGCGCCAGAAACTCGAGGCGCGCGGCGAACCGCGCCTGATCCATACCG
TGCGCGGCGTTGGCTATATCCTGCGCGAGGAATAA

Protein sequence :
MSAILIVEDEAEIAGYLRRGLTFEGYNVEIAADGRQALEIARERPPDLVVLDLMLPGIDGLEVARRLRAASDVPIIMLTA
RDAVPDRVAGLEAGADDYLIKPFAFEELLARIRVQLRRRQREDTATVLRYGPLTMDLTAHEVTIGDRRVDLTAKEYDLLE
LFMRHPQQVMTRDVIYDRVWGYNFGGESNIIEVYVRYLRQKLEARGEPRLIHTVRGVGYILREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-32 46
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_2487 YP_001432585.1 two component transcriptional regulator BAC0197 Protein 1e-33 50
Rcas_2487 YP_001432585.1 two component transcriptional regulator BAC0638 Protein 1e-30 49
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator BAC0083 Protein 4e-37 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-38 47
Rcas_2487 YP_001432585.1 two component transcriptional regulator BAC0125 Protein 6e-37 46
Rcas_2487 YP_001432585.1 two component transcriptional regulator BAC0308 Protein 5e-34 46
Rcas_2487 YP_001432585.1 two component transcriptional regulator BAC0111 Protein 3e-35 46
Rcas_2487 YP_001432585.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-32 46
Rcas_2487 YP_001432585.1 two component transcriptional regulator BAC0347 Protein 1e-31 44
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-21 43
Rcas_2487 YP_001432585.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-25 41
Rcas_2487 YP_001432585.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_2487 YP_001432585.1 two component transcriptional regulator VFG1390 Protein 5e-48 56
Rcas_2487 YP_001432585.1 two component transcriptional regulator VFG1389 Protein 6e-38 48
Rcas_2487 YP_001432585.1 two component transcriptional regulator VFG0596 Protein 1e-32 47
Rcas_2487 YP_001432585.1 two component transcriptional regulator VFG1386 Protein 9e-38 46
Rcas_2487 YP_001432585.1 two component transcriptional regulator VFG1563 Protein 2e-24 41
Rcas_2487 YP_001432585.1 two component transcriptional regulator VFG0473 Protein 6e-19 41