Gene Information

Name : Rcas_4351 (Rcas_4351)
Accession : YP_001434393.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5602657 - 5603394 bp
Length : 738 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_0188 two component transcriptional regulator, winged helix family

DNA sequence :
ATGACAACAATACTCCTGGTCGAAGATGATAGCGTTCTGCTCGAAACGCTCTCCTACAACTTTGAGCGGGCTGGCTTTCA
GGTGACCACGGCTGCCGACGGGCTGACCGGACTGGAGATGGTGCGGCAGGTTCGTCCTGATCTTATCATTCTCGATGTGA
TGTTGCCGGGGATTGACGGGTTTTCGGTCTGTCGTGCAGTGGCGAAAGAGACCGCCATTCCTATCGTGCTGCTGACCGCG
CTGCACGACGAAGCGCATCGTATCGCCGGGTTGGAACTTGGCGCTATCGACTATGTGGTGAAGCCATTCAGTATGGGCGA
GTTGCTGGCGCGTGTGCGGGCAATTCTGCGCTGGAACGAGCGTCAACGACAGGCGCCGACCTCCAACGTACTCAGCATTG
GTCCGGTGCAACTGGATCGCAACAGCCGGCGCGTCTGGTATCAGGATCGCGAAGTCGAACTCTCGCAGAAAGAGTTCGAT
CTCCTCGCCTGCCTGATGCACAACGCGGGAGTGGCGTTATCGCGCGATCTGCTCCTCGAGCGCGTCTGGGGGAACGATTT
CCTCGGATCAAACCGGACGATTGACGTTCACGTGCGTTGGCTGCGCGAAAAACTCGAGCCCGATCCCGCCAATCCCGTGT
TGATCCGCACAGTGCGCGGTATCGGATACTGTTTCCAGGACCCGTCGTTCGATCCGCTGGGACGACCGAGCCGCCAGGAA
CACGAACAGACATCCTGA

Protein sequence :
MTTILLVEDDSVLLETLSYNFERAGFQVTTAADGLTGLEMVRQVRPDLIILDVMLPGIDGFSVCRAVAKETAIPIVLLTA
LHDEAHRIAGLELGAIDYVVKPFSMGELLARVRAILRWNERQRQAPTSNVLSIGPVQLDRNSRRVWYQDREVELSQKEFD
LLACLMHNAGVALSRDLLLERVWGNDFLGSNRTIDVHVRWLREKLEPDPANPVLIRTVRGIGYCFQDPSFDPLGRPSRQE
HEQTS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-29 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_4351 YP_001434393.1 two component transcriptional regulator BAC0197 Protein 4e-31 44
Rcas_4351 YP_001434393.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-37 44
Rcas_4351 YP_001434393.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-47 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator BAC0125 Protein 1e-35 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-44 43
Rcas_4351 YP_001434393.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 42
Rcas_4351 YP_001434393.1 two component transcriptional regulator BAC0347 Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_4351 YP_001434393.1 two component transcriptional regulator VFG1389 Protein 2e-36 42
Rcas_4351 YP_001434393.1 two component transcriptional regulator VFG0596 Protein 3e-29 41
Rcas_4351 YP_001434393.1 two component transcriptional regulator VFG1390 Protein 1e-36 41